BLASTX nr result
ID: Sinomenium21_contig00031250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031250 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004956192.1| PREDICTED: delta(14)-sterol reductase-like [... 68 1e-09 tpg|DAA41486.1| TPA: hypothetical protein ZEAMMB73_369026 [Zea m... 67 3e-09 tpg|DAA41480.1| TPA: hypothetical protein ZEAMMB73_369026 [Zea m... 67 3e-09 ref|XP_002459826.1| hypothetical protein SORBIDRAFT_02g011460 [S... 67 3e-09 ref|NP_001147742.1| delta(14)-sterol reductase [Zea mays] gi|194... 67 3e-09 gb|EMT25703.1| Delta(14)-sterol reductase [Aegilops tauschii] 66 4e-09 gb|EMS64706.1| Delta(14)-sterol reductase [Triticum urartu] 66 4e-09 emb|CAP06398.1| sterol C-14 reductase [Triticum aestivum] 66 4e-09 emb|CAP06397.1| sterol C-14 reductase [Triticum turgidum subsp. ... 66 4e-09 emb|CAP06396.1| sterol C-14 reductase [Triticum turgidum subsp. ... 66 4e-09 emb|CAP06394.1| sterol C-14 reductase [Aegilops speltoides] 66 4e-09 emb|CAP06393.1| sterol C-14 reductase [Triticum urartu] 66 4e-09 emb|CAP06392.1| sterol C-14 reductase [Triticum aestivum] gi|205... 66 4e-09 emb|CAP06391.1| sterol C-14 reductase [Triticum aestivum] 66 4e-09 emb|CAP06389.1| sterol C-14 reductase [Triticum aestivum] gi|205... 66 4e-09 ref|XP_003578669.1| PREDICTED: delta(14)-sterol reductase-like [... 66 6e-09 dbj|BAJ92616.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 1e-08 ref|XP_006661554.1| PREDICTED: delta(14)-sterol reductase-like [... 64 2e-08 ref|NP_001172329.1| Os01g0354200 [Oryza sativa Japonica Group] g... 64 2e-08 ref|XP_002283576.1| PREDICTED: delta(14)-sterol reductase [Vitis... 64 2e-08 >ref|XP_004956192.1| PREDICTED: delta(14)-sterol reductase-like [Setaria italica] Length = 374 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYKE+WAEYCK+VPWRILPYVY Sbjct: 345 RDEARCSQKYKEIWAEYCKLVPWRILPYVY 374 >tpg|DAA41486.1| TPA: hypothetical protein ZEAMMB73_369026 [Zea mays] Length = 122 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KY+E+WAEYCK+VPWRILPYVY Sbjct: 93 RDEARCSQKYREIWAEYCKLVPWRILPYVY 122 >tpg|DAA41480.1| TPA: hypothetical protein ZEAMMB73_369026 [Zea mays] Length = 361 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KY+E+WAEYCK+VPWRILPYVY Sbjct: 332 RDEARCSQKYREIWAEYCKLVPWRILPYVY 361 >ref|XP_002459826.1| hypothetical protein SORBIDRAFT_02g011460 [Sorghum bicolor] gi|241923203|gb|EER96347.1| hypothetical protein SORBIDRAFT_02g011460 [Sorghum bicolor] Length = 370 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KY+E+WAEYCK+VPWRILPYVY Sbjct: 341 RDEARCSQKYREIWAEYCKLVPWRILPYVY 370 >ref|NP_001147742.1| delta(14)-sterol reductase [Zea mays] gi|194701770|gb|ACF84969.1| unknown [Zea mays] gi|195613410|gb|ACG28535.1| delta(14)-sterol reductase [Zea mays] gi|414590910|tpg|DAA41481.1| TPA: delta(14)-sterol reductase [Zea mays] Length = 370 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KY+E+WAEYCK+VPWRILPYVY Sbjct: 341 RDEARCSQKYREIWAEYCKLVPWRILPYVY 370 >gb|EMT25703.1| Delta(14)-sterol reductase [Aegilops tauschii] Length = 360 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 331 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 360 >gb|EMS64706.1| Delta(14)-sterol reductase [Triticum urartu] Length = 292 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 263 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 292 >emb|CAP06398.1| sterol C-14 reductase [Triticum aestivum] Length = 333 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 304 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 333 >emb|CAP06397.1| sterol C-14 reductase [Triticum turgidum subsp. durum] Length = 372 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 343 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 372 >emb|CAP06396.1| sterol C-14 reductase [Triticum turgidum subsp. durum] Length = 373 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 344 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 373 >emb|CAP06394.1| sterol C-14 reductase [Aegilops speltoides] Length = 373 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 344 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 373 >emb|CAP06393.1| sterol C-14 reductase [Triticum urartu] Length = 372 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 343 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 372 >emb|CAP06392.1| sterol C-14 reductase [Triticum aestivum] gi|205271118|emb|CAP06395.1| sterol C-14 reductase [Aegilops tauschii] Length = 374 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 345 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 374 >emb|CAP06391.1| sterol C-14 reductase [Triticum aestivum] Length = 372 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 343 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 372 >emb|CAP06389.1| sterol C-14 reductase [Triticum aestivum] gi|205271108|emb|CAP06390.1| sterol C-14 reductase [Triticum aestivum] Length = 373 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYK++WAEYCK+VPWRILPYVY Sbjct: 344 RDEARCSEKYKDIWAEYCKLVPWRILPYVY 373 >ref|XP_003578669.1| PREDICTED: delta(14)-sterol reductase-like [Brachypodium distachyon] Length = 372 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYKE+WAEYC +VPWRILPYVY Sbjct: 343 RDEARCSQKYKEIWAEYCNLVPWRILPYVY 372 >dbj|BAJ92616.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 370 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARC+ KYK++WAEYCK+VPWRILPYVY Sbjct: 341 RDEARCAEKYKDIWAEYCKLVPWRILPYVY 370 >ref|XP_006661554.1| PREDICTED: delta(14)-sterol reductase-like [Oryza brachyantha] Length = 367 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYKE+W EYCK+VPWRI PYVY Sbjct: 338 RDEARCSEKYKEIWVEYCKLVPWRIFPYVY 367 >ref|NP_001172329.1| Os01g0354200 [Oryza sativa Japonica Group] gi|255673212|dbj|BAH91059.1| Os01g0354200, partial [Oryza sativa Japonica Group] Length = 58 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARCS KYKE+W EYCK+VPWRI PYVY Sbjct: 29 RDEARCSEKYKEIWVEYCKLVPWRIFPYVY 58 >ref|XP_002283576.1| PREDICTED: delta(14)-sterol reductase [Vitis vinifera] gi|297740061|emb|CBI30243.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 RDEARCSLKYKEVWAEYCKIVPWRILPYVY 91 RDEARC+ KYKEVW EYC++VPWRILPY+Y Sbjct: 338 RDEARCAAKYKEVWTEYCRLVPWRILPYIY 367