BLASTX nr result
ID: Sinomenium21_contig00031145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031145 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC31626.1| Peptidyl-prolyl cis-trans isomerase CYP38 [Morus ... 56 5e-06 >gb|EXC31626.1| Peptidyl-prolyl cis-trans isomerase CYP38 [Morus notabilis] Length = 475 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 95 LRDPLKFAAADGFVVQTGDPEGPADGFIDPS 3 L D L FAAADGFVVQTGDPEGPA+GFIDPS Sbjct: 320 LIDFLCFAAADGFVVQTGDPEGPAEGFIDPS 350