BLASTX nr result
ID: Sinomenium21_contig00031060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031060 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846348.1| hypothetical protein AMTR_s00012p00259520 [A... 57 3e-06 gb|EXC10729.1| putative protein phosphatase 2C 24 [Morus notabilis] 56 6e-06 >ref|XP_006846348.1| hypothetical protein AMTR_s00012p00259520 [Amborella trichopoda] gi|548849118|gb|ERN08023.1| hypothetical protein AMTR_s00012p00259520 [Amborella trichopoda] Length = 426 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +3 Query: 297 MAEICYGVVSEKKTAEPGEPSSRAARRKRMKITRFKFI 410 MAEICYGVVS+ + + P EPSSRAARR+RM+I RFK + Sbjct: 1 MAEICYGVVSDGEASPPCEPSSRAARRRRMEIRRFKIV 38 >gb|EXC10729.1| putative protein phosphatase 2C 24 [Morus notabilis] Length = 412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 297 MAEICYGVVSEKKTAEPGEPSSRAARRKRMKITRFKFIT 413 MAEIC G+VS+ + + PGE SSR ARR+RM+I RFKF+T Sbjct: 1 MAEICCGIVSDGEASTPGESSSRTARRRRMEIRRFKFVT 39