BLASTX nr result
ID: Sinomenium21_contig00031041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00031041 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050407.1| DREB2A-interacting protein 2 isoform 1 [Theo... 59 9e-07 gb|EXB81323.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] 56 5e-06 ref|XP_006443904.1| hypothetical protein CICLE_v10020170mg [Citr... 56 6e-06 ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 56 6e-06 ref|XP_002315733.2| hypothetical protein POPTR_0010s08840g, part... 55 8e-06 ref|XP_004289907.1| PREDICTED: E3 ubiquitin protein ligase DRIP2... 55 8e-06 >ref|XP_007050407.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] gi|508702668|gb|EOX94564.1| DREB2A-interacting protein 2 isoform 1 [Theobroma cacao] Length = 429 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKV 278 LVDLWLQ+ASTSQRV A VG+ AKDFVMVL Y RK+ Sbjct: 391 LVDLWLQTASTSQRVPASVGSSAKDFVMVLGYARKI 426 >gb|EXB81323.1| E3 ubiquitin protein ligase DRIP2 [Morus notabilis] Length = 432 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 269 LVDLWLQ+ASTS+R+ A +G+ AKDFVMVL Y RK S Sbjct: 394 LVDLWLQTASTSERIPATIGSSAKDFVMVLVYARKAPES 432 >ref|XP_006443904.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|567902834|ref|XP_006443905.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|568851817|ref|XP_006479583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Citrus sinensis] gi|568851819|ref|XP_006479584.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Citrus sinensis] gi|557546166|gb|ESR57144.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] gi|557546167|gb|ESR57145.1| hypothetical protein CICLE_v10020170mg [Citrus clementina] Length = 441 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKVQ 275 LVDLWLQ+A+TS RV A +G+ AKDFVMVL Y RKV+ Sbjct: 402 LVDLWLQTAATSDRVPAMIGSSAKDFVMVLTYARKVR 438 >ref|XP_003520583.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] Length = 445 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKV 278 LV+LWL AST QR+ A +G+ AKDFVMVLAYGRKV Sbjct: 407 LVELWLDMASTPQRIPATIGSSAKDFVMVLAYGRKV 442 >ref|XP_002315733.2| hypothetical protein POPTR_0010s08840g, partial [Populus trichocarpa] gi|550329396|gb|EEF01904.2| hypothetical protein POPTR_0010s08840g, partial [Populus trichocarpa] Length = 445 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKVQP 272 LVD WLQ+AS S+R+ VG+ AKDFVMVL+YGRK P Sbjct: 407 LVDWWLQTASASERIRTTVGSSAKDFVMVLSYGRKAHP 444 >ref|XP_004289907.1| PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Fragaria vesca subsp. vesca] Length = 426 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 385 LVDLWLQSASTSQRVSACVGTPAKDFVMVLAYGRKVQPS 269 LVDLWLQ+AS +QR+ A +G+ AKDFVMVL Y RK+ S Sbjct: 388 LVDLWLQTASPTQRIPASIGSSAKDFVMVLGYSRKISKS 426