BLASTX nr result
ID: Sinomenium21_contig00030802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030802 (1311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172796.1| PREDICTED: polygalacturonase At1g48100-like,... 64 2e-07 ref|XP_007153746.1| hypothetical protein PHAVU_003G061600g [Phas... 61 1e-06 ref|XP_004142980.1| PREDICTED: polygalacturonase At1g48100-like ... 60 2e-06 ref|XP_006392146.1| hypothetical protein EUTSA_v10023404mg [Eutr... 60 3e-06 ref|XP_004509758.1| PREDICTED: polygalacturonase At1g48100-like ... 59 4e-06 ref|XP_003531999.2| PREDICTED: polygalacturonase At1g48100 isofo... 59 5e-06 gb|ABV25000.1| polygalacturonase 3 [Oncidium hybrid cultivar] 59 5e-06 gb|ABV24999.1| polygalacturonase 2 [Oncidium hybrid cultivar] 59 5e-06 ref|XP_004489829.1| PREDICTED: polygalacturonase At1g48100-like ... 59 6e-06 >ref|XP_004172796.1| PREDICTED: polygalacturonase At1g48100-like, partial [Cucumis sativus] Length = 159 Score = 63.5 bits (153), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 STV+VP+DYVFFVGPISFSGP CQP+I+FQVN Sbjct: 121 STVMVPADYVFFVGPISFSGPYCQPDIIFQVN 152 >ref|XP_007153746.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris] gi|561027100|gb|ESW25740.1| hypothetical protein PHAVU_003G061600g [Phaseolus vulgaris] Length = 534 Score = 60.8 bits (146), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST++VPSDYVFFVGPISFSGP C+PNIVFQ++ Sbjct: 152 STMVVPSDYVFFVGPISFSGPYCKPNIVFQLD 183 >ref|XP_004142980.1| PREDICTED: polygalacturonase At1g48100-like [Cucumis sativus] Length = 505 Score = 60.5 bits (145), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 STV+VP+DYVFFVGPISFSGP CQP+I+FQ++ Sbjct: 121 STVMVPADYVFFVGPISFSGPYCQPDIIFQLD 152 >ref|XP_006392146.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum] gi|557088652|gb|ESQ29432.1| hypothetical protein EUTSA_v10023404mg [Eutrema salsugineum] Length = 538 Score = 59.7 bits (143), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST+++PSDY+F VGPISFSGP CQPNIVFQ++ Sbjct: 153 STMIIPSDYIFLVGPISFSGPYCQPNIVFQLD 184 >ref|XP_004509758.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum] Length = 526 Score = 59.3 bits (142), Expect = 4e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST+L+P+DYVF+VGPI+FSGP C+PNIVFQV+ Sbjct: 143 STMLIPADYVFYVGPIAFSGPYCKPNIVFQVD 174 >ref|XP_003531999.2| PREDICTED: polygalacturonase At1g48100 isoform 1 [Glycine max] Length = 601 Score = 58.9 bits (141), Expect = 5e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST+LVP+DYVFFVGPISFSGP C+P+IVFQ++ Sbjct: 217 STMLVPADYVFFVGPISFSGPYCKPSIVFQLD 248 >gb|ABV25000.1| polygalacturonase 3 [Oncidium hybrid cultivar] Length = 483 Score = 58.9 bits (141), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST+ +PSDY FFVGPISFSGP CQPNI+FQ++ Sbjct: 121 STMQIPSDYTFFVGPISFSGPYCQPNIIFQLD 152 >gb|ABV24999.1| polygalacturonase 2 [Oncidium hybrid cultivar] Length = 483 Score = 58.9 bits (141), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST+ +PSDY FFVGPISFSGP CQPNI+FQ++ Sbjct: 121 STMQIPSDYTFFVGPISFSGPYCQPNIIFQLD 152 >ref|XP_004489829.1| PREDICTED: polygalacturonase At1g48100-like [Cicer arietinum] Length = 532 Score = 58.5 bits (140), Expect = 6e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -3 Query: 103 STVLVPSDYVFFVGPISFSGPLCQPNIVFQVN 8 ST++VP+DYVF+VGPISFSGP C+PNIVFQ++ Sbjct: 151 STMVVPADYVFYVGPISFSGPYCKPNIVFQLD 182