BLASTX nr result
ID: Sinomenium21_contig00030747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030747 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171783.1| PREDICTED: uncharacterized WD repeat-contain... 79 5e-13 ref|XP_004152294.1| PREDICTED: uncharacterized WD repeat-contain... 79 5e-13 gb|EXC14269.1| Uncharacterized WD repeat-containing protein [Mor... 79 6e-13 ref|XP_007034093.1| Transducin/WD40 repeat-like superfamily prot... 78 1e-12 ref|XP_007034092.1| Transducin/WD40 repeat-like superfamily prot... 78 1e-12 ref|XP_007222225.1| hypothetical protein PRUPE_ppa005865mg [Prun... 77 2e-12 ref|XP_002302896.2| hypothetical protein POPTR_0002s23480g [Popu... 77 3e-12 ref|XP_004296674.1| PREDICTED: uncharacterized WD repeat-contain... 77 3e-12 ref|XP_002526268.1| nucleotide binding protein, putative [Ricinu... 77 3e-12 emb|CBI39438.3| unnamed protein product [Vitis vinifera] 75 9e-12 ref|XP_002266620.1| PREDICTED: uncharacterized WD repeat-contain... 75 9e-12 gb|EYU32741.1| hypothetical protein MIMGU_mgv1a006804mg [Mimulus... 75 1e-11 ref|XP_002321094.2| hypothetical protein POPTR_0014s14450g [Popu... 74 2e-11 ref|XP_003518673.2| PREDICTED: uncharacterized WD repeat-contain... 74 3e-11 ref|XP_003552655.1| PREDICTED: uncharacterized WD repeat-contain... 74 3e-11 ref|XP_003621731.1| WD repeat-containing protein, putative [Medi... 73 4e-11 ref|XP_006407233.1| hypothetical protein EUTSA_v10020726mg [Eutr... 73 5e-11 ref|XP_006392612.1| hypothetical protein EUTSA_v10011474mg [Eutr... 72 6e-11 ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Popu... 72 6e-11 ref|XP_004492051.1| PREDICTED: uncharacterized WD repeat-contain... 72 8e-11 >ref|XP_004171783.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Cucumis sativus] Length = 438 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+L+IG+WDR++ASLL YNR+ YGY+DSF+ Sbjct: 394 FFGEISGVSLSPDDESLYIGIWDRTYASLLQYNRRHTYGYIDSFL 438 >ref|XP_004152294.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Cucumis sativus] Length = 455 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+L+IG+WDR++ASLL YNR+ YGY+DSF+ Sbjct: 394 FFGEISGVSLSPDDESLYIGIWDRTYASLLQYNRRHTYGYIDSFL 438 >gb|EXC14269.1| Uncharacterized WD repeat-containing protein [Morus notabilis] Length = 440 Score = 79.0 bits (193), Expect = 6e-13 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+L+IG+WDR++ASLL YNR+ YGYLDS++ Sbjct: 396 FFGEISGVSLSPDDESLYIGIWDRTYASLLQYNRRHTYGYLDSYL 440 >ref|XP_007034093.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508713122|gb|EOY05019.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 356 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+L+IG+WDR++ASLL YN++ YGYLDS++ Sbjct: 312 FFGEISGVSLSPDDESLYIGIWDRTYASLLQYNKRHTYGYLDSYL 356 >ref|XP_007034092.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713121|gb|EOY05018.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 438 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+L+IG+WDR++ASLL YN++ YGYLDS++ Sbjct: 394 FFGEISGVSLSPDDESLYIGIWDRTYASLLQYNKRHTYGYLDSYL 438 >ref|XP_007222225.1| hypothetical protein PRUPE_ppa005865mg [Prunus persica] gi|462419161|gb|EMJ23424.1| hypothetical protein PRUPE_ppa005865mg [Prunus persica] Length = 440 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+S+SPDDE+L+IG+WDR++ASLL YNR+ YGYLDS+ Sbjct: 396 FFGEISGVSVSPDDESLYIGIWDRTYASLLQYNRRHTYGYLDSY 439 >ref|XP_002302896.2| hypothetical protein POPTR_0002s23480g [Populus trichocarpa] gi|550345673|gb|EEE82169.2| hypothetical protein POPTR_0002s23480g [Populus trichocarpa] Length = 447 Score = 76.6 bits (187), Expect = 3e-12 Identities = 30/45 (66%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G++LSPDDE+L+IG+WDR++ASLL YN++ YGYLDS++ Sbjct: 403 FFGEISGVALSPDDESLYIGIWDRTYASLLQYNKRHTYGYLDSYL 447 >ref|XP_004296674.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Fragaria vesca subsp. vesca] Length = 444 Score = 76.6 bits (187), Expect = 3e-12 Identities = 31/44 (70%), Positives = 40/44 (90%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+S SPDDE+L+IG+WDR++ASLL YNR+ YGYLDS+ Sbjct: 400 FFGEISGVSASPDDESLYIGIWDRTYASLLQYNRRHTYGYLDSY 443 >ref|XP_002526268.1| nucleotide binding protein, putative [Ricinus communis] gi|223534413|gb|EEF36118.1| nucleotide binding protein, putative [Ricinus communis] Length = 196 Score = 76.6 bits (187), Expect = 3e-12 Identities = 30/45 (66%), Positives = 42/45 (93%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G++LSPDDE+L+IG+WDR++ASLL YN++ YGYLDS++ Sbjct: 152 FFGEISGVALSPDDESLYIGIWDRTYASLLQYNKRHTYGYLDSYL 196 >emb|CBI39438.3| unnamed protein product [Vitis vinifera] Length = 528 Score = 75.1 bits (183), Expect = 9e-12 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE L+IG+WDR++ASLL YN++ YGYLD ++ Sbjct: 484 FFGEISGVSLSPDDEALYIGIWDRTYASLLQYNKRHKYGYLDCYL 528 >ref|XP_002266620.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03 [Vitis vinifera] Length = 443 Score = 75.1 bits (183), Expect = 9e-12 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE L+IG+WDR++ASLL YN++ YGYLD ++ Sbjct: 399 FFGEISGVSLSPDDEALYIGIWDRTYASLLQYNKRHKYGYLDCYL 443 >gb|EYU32741.1| hypothetical protein MIMGU_mgv1a006804mg [Mimulus guttatus] Length = 430 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+SLSPDDE+++IG+WDR++ASLL YNR+ Y YLDS + Sbjct: 386 FFGEISGVSLSPDDESIYIGIWDRTYASLLQYNRRHTYEYLDSLI 430 >ref|XP_002321094.2| hypothetical protein POPTR_0014s14450g [Populus trichocarpa] gi|566204272|ref|XP_006375503.1| hypothetical protein POPTR_0014s14450g [Populus trichocarpa] gi|550324193|gb|EEE99409.2| hypothetical protein POPTR_0014s14450g [Populus trichocarpa] gi|550324194|gb|ERP53300.1| hypothetical protein POPTR_0014s14450g [Populus trichocarpa] Length = 443 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/45 (66%), Positives = 41/45 (91%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G++LSPDDE+L IG+WDR++ASLL YN++ YGYLDS++ Sbjct: 399 FFGEISGVALSPDDESLSIGIWDRTYASLLQYNKRHKYGYLDSYL 443 >ref|XP_003518673.2| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Glycine max] Length = 441 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+SLSPDDE ++IG+WDR++ASLL YNRK Y YLD++ Sbjct: 397 FFGEISGVSLSPDDECMYIGIWDRTYASLLQYNRKHQYKYLDAY 440 >ref|XP_003552655.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like [Glycine max] Length = 440 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+SLSPDDE ++IG+WDR++ASLL YNRK Y YLD++ Sbjct: 397 FFGEISGVSLSPDDECIYIGIWDRTYASLLQYNRKHQYKYLDAY 440 >ref|XP_003621731.1| WD repeat-containing protein, putative [Medicago truncatula] gi|355496746|gb|AES77949.1| WD repeat-containing protein, putative [Medicago truncatula] gi|388495050|gb|AFK35591.1| unknown [Medicago truncatula] Length = 440 Score = 73.2 bits (178), Expect = 4e-11 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+S+SPDDE ++IG+WDR++ASLL YNR+ +Y YLDS+ Sbjct: 396 FFGEISGVSVSPDDECMYIGIWDRTYASLLQYNRRHSYHYLDSY 439 >ref|XP_006407233.1| hypothetical protein EUTSA_v10020726mg [Eutrema salsugineum] gi|557108379|gb|ESQ48686.1| hypothetical protein EUTSA_v10020726mg [Eutrema salsugineum] Length = 447 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+GIS SPD E LFIGVWDR++ SLL Y+R+R Y YLDSF+ Sbjct: 403 FFGEISGISFSPDTEALFIGVWDRTYGSLLEYHRRRDYSYLDSFL 447 >ref|XP_006392612.1| hypothetical protein EUTSA_v10011474mg [Eutrema salsugineum] gi|557089190|gb|ESQ29898.1| hypothetical protein EUTSA_v10011474mg [Eutrema salsugineum] Length = 449 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+GIS SPD E LFIGVWDR++ SLL Y R+R Y YLDSF+ Sbjct: 405 FFGEISGISFSPDTEALFIGVWDRTYGSLLEYGRRRNYSYLDSFL 449 >ref|XP_002308733.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] gi|222854709|gb|EEE92256.1| hypothetical protein POPTR_0006s00270g [Populus trichocarpa] Length = 448 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSFV 137 FFGEI+G+S SPD E+LFIGVWDR++ SLL YNR+R+Y Y+DS + Sbjct: 404 FFGEISGVSFSPDTESLFIGVWDRTYGSLLQYNRRRSYSYVDSLM 448 >ref|XP_004492051.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Cicer arietinum] Length = 436 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 FFGEITGISLSPDDETLFIGVWDRSHASLLHYNRKRAYGYLDSF 134 FFGEI+G+ LSPDDE +++G+WDR++ASLL YNR+ +Y YLDS+ Sbjct: 392 FFGEISGVCLSPDDECMYVGIWDRTYASLLQYNRRHSYHYLDSY 435