BLASTX nr result
ID: Sinomenium21_contig00030528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030528 (655 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006604468.1| PREDICTED: uncharacterized protein LOC100790... 74 5e-11 ref|XP_004507572.1| PREDICTED: uncharacterized protein LOC101490... 72 2e-10 ref|XP_002274823.1| PREDICTED: uncharacterized protein LOC100254... 69 1e-09 ref|XP_007162472.1| hypothetical protein PHAVU_001G155300g [Phas... 66 1e-08 ref|XP_006828634.1| hypothetical protein AMTR_s00129p00094590 [A... 64 4e-08 ref|XP_002974266.1| hypothetical protein SELMODRAFT_101436 [Sela... 63 7e-08 ref|XP_007050465.1| Uncharacterized protein TCM_004256 [Theobrom... 62 1e-07 ref|XP_002985636.1| hypothetical protein SELMODRAFT_122681 [Sela... 61 4e-07 ref|XP_007199266.1| hypothetical protein PRUPE_ppa022690mg, part... 60 6e-07 gb|EXB26549.1| hypothetical protein L484_012538 [Morus notabilis] 60 8e-07 ref|XP_002300815.1| hypothetical protein POPTR_0002s04820g [Popu... 59 1e-06 ref|XP_004172130.1| PREDICTED: uncharacterized LOC101205543 [Cuc... 58 3e-06 ref|XP_004145367.1| PREDICTED: uncharacterized protein LOC101218... 58 3e-06 ref|XP_002520953.1| conserved hypothetical protein [Ricinus comm... 57 7e-06 >ref|XP_006604468.1| PREDICTED: uncharacterized protein LOC100790558 [Glycine max] Length = 213 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = +1 Query: 478 MAVQATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 M D DD+SPS+T+I FD P+P RGPL AG SD+PS GP+VLAF+D+ +W S+ Sbjct: 1 MDASEPDNVDDYSPSSTVIKFDRPVPLLRGPLPAGPSDDPSAGPYVLAFRDSRAWASS 58 >ref|XP_004507572.1| PREDICTED: uncharacterized protein LOC101490204 [Cicer arietinum] Length = 178 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +1 Query: 481 AVQATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 A ++T +D+SPS+T+I FD PIP RGPL A SD+PS GPFVLAFKD+++W ++ Sbjct: 3 ASESTKYEEDYSPSSTVIKFDRPIPSLRGPLPASPSDDPSAGPFVLAFKDSQAWATS 59 >ref|XP_002274823.1| PREDICTED: uncharacterized protein LOC100254442 [Vitis vinifera] gi|296084494|emb|CBI25053.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +1 Query: 499 EADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 + D+SPSATI FD P+P RGP+ A SD+PS GPFVLAF+D+ +WRSA Sbjct: 6 DLSDYSPSATITPFDCPVPLLRGPVPASPSDDPSAGPFVLAFRDSRAWRSA 56 >ref|XP_007162472.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] gi|593798870|ref|XP_007162473.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] gi|593798872|ref|XP_007162474.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] gi|561035936|gb|ESW34466.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] gi|561035937|gb|ESW34467.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] gi|561035938|gb|ESW34468.1| hypothetical protein PHAVU_001G155300g [Phaseolus vulgaris] Length = 212 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 478 MAVQATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 M D D+SPS+T+I FD P+ RGPL AG SDEPS G +VLAF+D+ +W S+ Sbjct: 1 MDASVPDNVVDYSPSSTVIEFDRPVSLLRGPLPAGRSDEPSAGTYVLAFRDSRAWASS 58 >ref|XP_006828634.1| hypothetical protein AMTR_s00129p00094590 [Amborella trichopoda] gi|548833424|gb|ERM96050.1| hypothetical protein AMTR_s00129p00094590 [Amborella trichopoda] Length = 68 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +1 Query: 499 EADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 E +D+S +AT++ FDPPI RGP+ A D+PS G FVLAFKD SWR A Sbjct: 4 ETEDYSAAATVVGFDPPISLLRGPVPASSIDDPSKGDFVLAFKDERSWRRA 54 >ref|XP_002974266.1| hypothetical protein SELMODRAFT_101436 [Selaginella moellendorffii] gi|300157864|gb|EFJ24488.1| hypothetical protein SELMODRAFT_101436 [Selaginella moellendorffii] Length = 238 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/54 (57%), Positives = 37/54 (68%) Frame = +1 Query: 490 ATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 A+ + D SPSAT IAF+P +P R P+ AG D+PS GPFVLAFKD SW A Sbjct: 41 ASAHSTDLSPSATTIAFEPVLPVLRVPVPAGSDDDPSKGPFVLAFKDEASWSRA 94 >ref|XP_007050465.1| Uncharacterized protein TCM_004256 [Theobroma cacao] gi|508702726|gb|EOX94622.1| Uncharacterized protein TCM_004256 [Theobroma cacao] Length = 201 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +1 Query: 508 DFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 D+S S+TII FD PIP RGP+ AG SD+PS G ++LAFKD SW +A Sbjct: 11 DYSASSTIIKFDRPIPLLRGPIPAGSSDDPSSGSYLLAFKDLPSWAAA 58 >ref|XP_002985636.1| hypothetical protein SELMODRAFT_122681 [Selaginella moellendorffii] gi|300146545|gb|EFJ13214.1| hypothetical protein SELMODRAFT_122681 [Selaginella moellendorffii] Length = 284 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +1 Query: 490 ATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 A+ + D SPSA IAF+P +P R P+ AG D+PS GPFVLAFKD SW A Sbjct: 41 ASAHSTDLSPSAITIAFEPVLPVLRVPVPAGSDDDPSKGPFVLAFKDEASWSRA 94 >ref|XP_007199266.1| hypothetical protein PRUPE_ppa022690mg, partial [Prunus persica] gi|462394666|gb|EMJ00465.1| hypothetical protein PRUPE_ppa022690mg, partial [Prunus persica] Length = 178 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = +1 Query: 478 MAVQATDEADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 MA ++ D+ S ++T I FD PIP RGP+ AG D+PS GP+VLAF+D +W +A Sbjct: 1 MADSESNYIDEHSAASTTITFDRPIPLLRGPVRAGPPDDPSSGPYVLAFRDPRTWANA 58 >gb|EXB26549.1| hypothetical protein L484_012538 [Morus notabilis] Length = 218 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +1 Query: 499 EADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 + +++S S+T I FD +P RGP+ +G D+PS GP+VLAF+DA +WR+A Sbjct: 9 DLEEYSASSTTIVFDRLVPLLRGPVRSGPGDDPSAGPYVLAFRDARAWRNA 59 >ref|XP_002300815.1| hypothetical protein POPTR_0002s04820g [Populus trichocarpa] gi|222842541|gb|EEE80088.1| hypothetical protein POPTR_0002s04820g [Populus trichocarpa] Length = 201 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +1 Query: 505 DDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 D++S SAT I FD PIP RGP+ AG D+PSI P VLAF+ +SW A Sbjct: 10 DEYSASATTIKFDRPIPLLRGPIPAGPPDDPSISPHVLAFRSPQSWAVA 58 >ref|XP_004172130.1| PREDICTED: uncharacterized LOC101205543 [Cucumis sativus] Length = 151 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 508 DFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 ++S S+TII F PIP RGP+ A S+ PS GP++LAF+D ++W SA Sbjct: 11 EYSSSSTIITFQRPIPLLRGPVRASQSENPSAGPYLLAFRDRQAWESA 58 >ref|XP_004145367.1| PREDICTED: uncharacterized protein LOC101218153 [Cucumis sativus] gi|449472029|ref|XP_004153474.1| PREDICTED: uncharacterized protein LOC101205543 [Cucumis sativus] Length = 162 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 508 DFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 ++S S+TII F PIP RGP+ A S+ PS GP++LAF+D ++W SA Sbjct: 22 EYSSSSTIITFQRPIPLLRGPVRASQSENPSAGPYLLAFRDRQAWESA 69 >ref|XP_002520953.1| conserved hypothetical protein [Ricinus communis] gi|223539790|gb|EEF41370.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +1 Query: 499 EADDFSPSATIIAFDPPIP*RRGPLTAGLSDEPSIGPFVLAFKDAESWRSA 651 + D++S SAT I FD IP RGP+ A SD+PS GP+ LAF++ +SW +A Sbjct: 8 DLDEYSASATTIEFDFQIPLLRGPIPAAESDDPSSGPYFLAFRNPQSWATA 58