BLASTX nr result
ID: Sinomenium21_contig00030483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030483 (1278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512489.1| 3-5 exonuclease, putative [Ricinus communis]... 64 1e-07 >ref|XP_002512489.1| 3-5 exonuclease, putative [Ricinus communis] gi|223548450|gb|EEF49941.1| 3-5 exonuclease, putative [Ricinus communis] Length = 570 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/50 (52%), Positives = 38/50 (76%) Frame = -3 Query: 157 GIVGVVQMDERKAHQTQAVCLHAFSDLSHTSPTIFMYLLKECYVRGTRKA 8 G+ + + + KA+QT +CLHAFSDL++ SP +F+YLLKECY+ G+ KA Sbjct: 2 GLEETIDIKKDKANQTLTICLHAFSDLTYVSPVVFLYLLKECYIHGSCKA 51