BLASTX nr result
ID: Sinomenium21_contig00030388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030388 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35242.1| hypothetical protein MIMGU_mgv1a016986mg [Mimulus... 76 6e-12 ref|XP_007150358.1| hypothetical protein PHAVU_005G146900g [Phas... 74 2e-11 ref|XP_007150357.1| hypothetical protein PHAVU_005G146900g [Phas... 74 2e-11 ref|XP_004241206.1| PREDICTED: transcription elongation factor B... 74 3e-11 ref|XP_002282124.1| PREDICTED: transcription elongation factor B... 74 3e-11 ref|XP_002520493.1| Transcription elongation factor B polypeptid... 73 4e-11 ref|XP_007016290.1| BTB/POZ domain-containing protein [Theobroma... 72 8e-11 ref|NP_001235513.1| uncharacterized protein LOC100305702 [Glycin... 72 8e-11 emb|CAN62731.1| hypothetical protein VITISV_031983 [Vitis vinifera] 72 8e-11 ref|XP_004507151.1| PREDICTED: transcription elongation factor B... 72 1e-10 gb|AFK42716.1| unknown [Medicago truncatula] 72 1e-10 ref|XP_007206186.1| hypothetical protein PRUPE_ppa013881mg [Prun... 71 2e-10 ref|XP_006424933.1| hypothetical protein CICLE_v10029658mg [Citr... 70 2e-10 ref|XP_006424932.1| hypothetical protein CICLE_v10029658mg [Citr... 70 2e-10 ref|XP_002314149.1| hypothetical protein POPTR_0009s04270g [Popu... 70 2e-10 ref|XP_004145280.1| PREDICTED: transcription elongation factor B... 70 4e-10 gb|EXC10738.1| Transcription elongation factor B polypeptide 1 [... 69 5e-10 ref|NP_001236759.1| uncharacterized protein LOC100500097 [Glycin... 69 5e-10 gb|EPS59254.1| hypothetical protein M569_15556 [Genlisea aurea] 69 7e-10 ref|XP_004291523.1| PREDICTED: transcription elongation factor B... 69 7e-10 >gb|EYU35242.1| hypothetical protein MIMGU_mgv1a016986mg [Mimulus guttatus] gi|604330123|gb|EYU35243.1| hypothetical protein MIMGU_mgv1a016986mg [Mimulus guttatus] Length = 98 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS Sbjct: 1 MKKEDTVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 39 >ref|XP_007150358.1| hypothetical protein PHAVU_005G146900g [Phaseolus vulgaris] gi|561023622|gb|ESW22352.1| hypothetical protein PHAVU_005G146900g [Phaseolus vulgaris] Length = 145 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 KMKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 KMKKE+TVKLISAEGFEFV+DK+AAMVSQTI NMLTSPGS Sbjct: 47 KMKKEDTVKLISAEGFEFVVDKEAAMVSQTIHNMLTSPGS 86 >ref|XP_007150357.1| hypothetical protein PHAVU_005G146900g [Phaseolus vulgaris] gi|561023621|gb|ESW22351.1| hypothetical protein PHAVU_005G146900g [Phaseolus vulgaris] Length = 124 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -1 Query: 122 KMKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 KMKKE+TVKLISAEGFEFV+DK+AAMVSQTI NMLTSPGS Sbjct: 47 KMKKEDTVKLISAEGFEFVVDKEAAMVSQTIHNMLTSPGS 86 >ref|XP_004241206.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform 1 [Solanum lycopersicum] gi|460391192|ref|XP_004241207.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform 2 [Solanum lycopersicum] gi|565368319|ref|XP_006350794.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Solanum tuberosum] Length = 98 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLIS EGFEF+IDKKAAMVSQTIRNMLTSPGS Sbjct: 1 MKKEDTVKLISREGFEFIIDKKAAMVSQTIRNMLTSPGS 39 >ref|XP_002282124.1| PREDICTED: transcription elongation factor B polypeptide 1 [Vitis vinifera] Length = 98 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 M+KE+TVKLISAEGFEFVIDK+AAMVSQTIRNMLTSPGS Sbjct: 1 MRKEDTVKLISAEGFEFVIDKRAAMVSQTIRNMLTSPGS 39 >ref|XP_002520493.1| Transcription elongation factor B polypeptide, putative [Ricinus communis] gi|223540335|gb|EEF41906.1| Transcription elongation factor B polypeptide, putative [Ricinus communis] Length = 98 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 M+KE+TVKLISAEGFEFVIDK+AAMVSQTIRNMLTSPGS Sbjct: 1 MRKEDTVKLISAEGFEFVIDKEAAMVSQTIRNMLTSPGS 39 >ref|XP_007016290.1| BTB/POZ domain-containing protein [Theobroma cacao] gi|508786653|gb|EOY33909.1| BTB/POZ domain-containing protein [Theobroma cacao] Length = 98 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLISAEG EFVIDK+AAMVSQTIRNMLTSPGS Sbjct: 1 MKKEDTVKLISAEGMEFVIDKEAAMVSQTIRNMLTSPGS 39 >ref|NP_001235513.1| uncharacterized protein LOC100305702 [Glycine max] gi|255626357|gb|ACU13523.1| unknown [Glycine max] Length = 98 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLISAEGFEFV+DK+AAMVSQTI NMLTSPGS Sbjct: 1 MKKEDTVKLISAEGFEFVVDKEAAMVSQTIHNMLTSPGS 39 >emb|CAN62731.1| hypothetical protein VITISV_031983 [Vitis vinifera] Length = 353 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPG 6 M+KE+TVKLISAEGFEFVIDK+AAMVSQTIRNMLTSPG Sbjct: 1 MRKEDTVKLISAEGFEFVIDKRAAMVSQTIRNMLTSPG 38 >ref|XP_004507151.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform X1 [Cicer arietinum] gi|502148401|ref|XP_004507152.1| PREDICTED: transcription elongation factor B polypeptide 1-like isoform X2 [Cicer arietinum] Length = 98 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLIS++GFEFV+DK+AAMVSQTIRNMLTSPGS Sbjct: 1 MKKEDTVKLISSDGFEFVVDKEAAMVSQTIRNMLTSPGS 39 >gb|AFK42716.1| unknown [Medicago truncatula] Length = 98 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/39 (87%), Positives = 39/39 (100%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLIS++GFEFV+DK+AAMVSQTIRNMLTSPGS Sbjct: 1 MKKEDTVKLISSDGFEFVVDKEAAMVSQTIRNMLTSPGS 39 >ref|XP_007206186.1| hypothetical protein PRUPE_ppa013881mg [Prunus persica] gi|462401828|gb|EMJ07385.1| hypothetical protein PRUPE_ppa013881mg [Prunus persica] Length = 98 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 M+KEETVKLISAEGFEFVI K AAMVSQTIRNMLTSPGS Sbjct: 1 MRKEETVKLISAEGFEFVIHKDAAMVSQTIRNMLTSPGS 39 >ref|XP_006424933.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] gi|568870426|ref|XP_006488405.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Citrus sinensis] gi|557526867|gb|ESR38173.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] Length = 98 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPG 6 MKKE+TVKLISAEGFEFVI K+AAMVSQTIRNMLTSPG Sbjct: 1 MKKEDTVKLISAEGFEFVISKEAAMVSQTIRNMLTSPG 38 >ref|XP_006424932.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] gi|557526866|gb|ESR38172.1| hypothetical protein CICLE_v10029658mg [Citrus clementina] Length = 73 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPG 6 MKKE+TVKLISAEGFEFVI K+AAMVSQTIRNMLTSPG Sbjct: 1 MKKEDTVKLISAEGFEFVISKEAAMVSQTIRNMLTSPG 38 >ref|XP_002314149.1| hypothetical protein POPTR_0009s04270g [Populus trichocarpa] gi|222850557|gb|EEE88104.1| hypothetical protein POPTR_0009s04270g [Populus trichocarpa] Length = 98 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 M+KE+TVKLISAEGFEFVI K+AAMVSQTIRNMLTSPGS Sbjct: 1 MRKEDTVKLISAEGFEFVIHKEAAMVSQTIRNMLTSPGS 39 >ref|XP_004145280.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] gi|449474021|ref|XP_004154051.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] gi|449508510|ref|XP_004163332.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Cucumis sativus] Length = 98 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLISAEGFEFVI K AAMVSQTIRNMLTSPG+ Sbjct: 1 MKKEDTVKLISAEGFEFVIHKDAAMVSQTIRNMLTSPGN 39 >gb|EXC10738.1| Transcription elongation factor B polypeptide 1 [Morus notabilis] Length = 98 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 M+KE+TVKLISAEGFEFV+ K AAMVSQTIRNMLTSPGS Sbjct: 1 MRKEDTVKLISAEGFEFVVHKDAAMVSQTIRNMLTSPGS 39 >ref|NP_001236759.1| uncharacterized protein LOC100500097 [Glycine max] gi|571513894|ref|XP_006596971.1| PREDICTED: uncharacterized protein LOC100500097 isoform X1 [Glycine max] gi|255629123|gb|ACU14906.1| unknown [Glycine max] Length = 98 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPGS 3 MKKE+TVKLIS+EGFEFV+DK+AA+VSQTI NMLTSPGS Sbjct: 1 MKKEDTVKLISSEGFEFVVDKEAAIVSQTIHNMLTSPGS 39 >gb|EPS59254.1| hypothetical protein M569_15556 [Genlisea aurea] Length = 98 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPG 6 MKKE VKLISAEGFEFVIDKKAAMVSQTIRNM TSPG Sbjct: 1 MKKEGMVKLISAEGFEFVIDKKAAMVSQTIRNMFTSPG 38 >ref|XP_004291523.1| PREDICTED: transcription elongation factor B polypeptide 1-like [Fragaria vesca subsp. vesca] Length = 98 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 119 MKKEETVKLISAEGFEFVIDKKAAMVSQTIRNMLTSPG 6 MKKE+TVKLISAEGFEFV+ K AAMVSQTIRNMLTSPG Sbjct: 1 MKKEDTVKLISAEGFEFVVHKDAAMVSQTIRNMLTSPG 38