BLASTX nr result
ID: Sinomenium21_contig00030206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00030206 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65705.1| hypothetical protein VITISV_001744 [Vitis vinifera] 56 6e-06 >emb|CAN65705.1| hypothetical protein VITISV_001744 [Vitis vinifera] Length = 654 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 14 IGEFCTFMRSAASEREWMKTRAALSGALKKKSNE 115 IGE C+FMR+AAS +EW KT+AALSG+LKKK+NE Sbjct: 616 IGETCSFMRTAASVKEWSKTKAALSGSLKKKNNE 649