BLASTX nr result
ID: Sinomenium21_contig00029502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00029502 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 56 6e-06 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 296 DLMQASRPYVCLSPSWCVLCTEAEEIVDCLFLHYGYSQVIWGKI 165 D +Q +P +CLSPSWCVLC E E +D LFLH YS +W K+ Sbjct: 811 DCIQRRQPKMCLSPSWCVLCKENAENIDHLFLHCSYSLRLWWKM 854