BLASTX nr result
ID: Sinomenium21_contig00029334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00029334 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 55 5e-07 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 54.7 bits (130), Expect(2) = 5e-07 Identities = 20/42 (47%), Positives = 31/42 (73%) Frame = -2 Query: 126 KTPLKIEIFGWLLEIRKINTMDLLQNSGPYLYLFHSWCVLCR 1 K+P K+++F WL+ + K+NT DL+Q P++YL WCVLC+ Sbjct: 130 KSPPKVKVFVWLVALGKVNTSDLVQRKRPFMYLSPQWCVLCK 171 Score = 24.6 bits (52), Expect(2) = 5e-07 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 296 SMTKSSCKSYFRNIIDCPSIPSFDQNNFIWKNKISLKIKIY 174 S T S +S+ RN + P F + +WK K K+K++ Sbjct: 101 SFTCKSFQSFLRNKGRAETFPPF---SLVWKAKSPPKVKVF 138