BLASTX nr result
ID: Sinomenium21_contig00028976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00028976 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307202.1| PREDICTED: choline/ethanolamine kinase-like ... 58 2e-06 ref|XP_002306722.2| hypothetical protein POPTR_0005s21940g [Popu... 55 8e-06 >ref|XP_004307202.1| PREDICTED: choline/ethanolamine kinase-like [Fragaria vesca subsp. vesca] Length = 358 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/45 (57%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 1 EHVNKINFDFIEYARQRFEQYWSTKSAILGS-SSDLLNGSVNNCA 132 EHVN I+FD++EYA+QRF+QYW TK+++LGS S G+ NCA Sbjct: 313 EHVNDIDFDYLEYAKQRFQQYWRTKASLLGSVGSSPDTGTDGNCA 357 >ref|XP_002306722.2| hypothetical protein POPTR_0005s21940g [Populus trichocarpa] gi|550339497|gb|EEE93718.2| hypothetical protein POPTR_0005s21940g [Populus trichocarpa] Length = 410 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/39 (58%), Positives = 31/39 (79%) Frame = +1 Query: 4 HVNKINFDFIEYARQRFEQYWSTKSAILGSSSDLLNGSV 120 +VNKI+FD++EYARQRF QYW K +LGS+ + +NG V Sbjct: 365 YVNKIDFDYMEYARQRFRQYWLRKKRLLGSADNYVNGHV 403