BLASTX nr result
ID: Sinomenium21_contig00028935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00028935 (547 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585638.1| putative stress protein ddr48 protein [Neofu... 59 8e-07 gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyen... 56 7e-06 >ref|XP_007585638.1| putative stress protein ddr48 protein [Neofusicoccum parvum UCRNP2] gi|485921084|gb|EOD46894.1| putative stress protein ddr48 protein [Neofusicoccum parvum UCRNP2] Length = 287 Score = 58.9 bits (141), Expect = 8e-07 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +3 Query: 342 TAGKLLEKAGNLFKNDGLAEKGRAKRDDAG-AYDNDSYGSSGR-GNDNNY 485 T GKL+EKAG++ K++ + EKG KR+ AG DNDSYGSSGR GND++Y Sbjct: 85 TIGKLMEKAGSVLKSEKVEEKGHQKREQAGLGRDNDSYGSSGRGGNDSSY 134 >gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyensis ATCC 20868] Length = 306 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +3 Query: 342 TAGKLLEKAGNLFKNDGLAEKGRAKRDDAGAYDNDSYGSSGRGNDNN 482 T GKL+EKAG + KN+GL EKG+ KR AG ND YGS N+NN Sbjct: 261 TMGKLMEKAGGMLKNEGLVEKGQQKRAGAG---NDEYGSGNNNNNNN 304