BLASTX nr result
ID: Sinomenium21_contig00028567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00028567 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440045.1| hypothetical protein CICLE_v10024026mg [Citr... 59 9e-07 ref|XP_006440044.1| hypothetical protein CICLE_v10023121mg [Citr... 58 2e-06 ref|XP_006476977.1| PREDICTED: uncharacterized protein LOC102622... 57 4e-06 >ref|XP_006440045.1| hypothetical protein CICLE_v10024026mg [Citrus clementina] gi|557542307|gb|ESR53285.1| hypothetical protein CICLE_v10024026mg [Citrus clementina] Length = 169 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 136 DMLGRVRAPPSSLDYLELERLPSKQMKDDGLSIYEITLQKLRLGS 2 +MLGRVRA S+ LELER+PSK +KDD LSIYE TL KL+LG+ Sbjct: 87 EMLGRVRAASSTPYDLELERMPSKLIKDDSLSIYEATLMKLKLGA 131 >ref|XP_006440044.1| hypothetical protein CICLE_v10023121mg [Citrus clementina] gi|557542306|gb|ESR53284.1| hypothetical protein CICLE_v10023121mg [Citrus clementina] Length = 82 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 133 MLGRVRAPPSSLDYLELERLPSKQMKDDGLSIYEITLQKLRLGS 2 MLGRVRA S+ LELER+PSK +KDD LSIYE TL KL+LG+ Sbjct: 1 MLGRVRAASSTPYDLELERMPSKLIKDDSLSIYEATLMKLKLGA 44 >ref|XP_006476977.1| PREDICTED: uncharacterized protein LOC102622565 [Citrus sinensis] Length = 198 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 133 MLGRVRAPPSSLDYLELERLPSKQMKDDGLSIYEITLQKLRLGS 2 MLGRVRA S+ LELER PSK +KDD LSIYE TL KL+LG+ Sbjct: 1 MLGRVRAASSTPYDLELERTPSKLIKDDSLSIYEATLMKLKLGA 44