BLASTX nr result
ID: Sinomenium21_contig00028425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00028425 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38862.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_007052035.1| Tetratricopeptide repeat (TPR)-like superfam... 67 3e-09 gb|AFK47264.1| unknown [Lotus japonicus] 67 3e-09 ref|XP_002320730.1| hypothetical protein POPTR_0014s06610g [Popu... 66 4e-09 ref|XP_004492640.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_007140011.1| hypothetical protein PHAVU_008G076800g [Phas... 64 2e-08 gb|EXB52663.1| hypothetical protein L484_022440 [Morus notabilis] 64 3e-08 ref|XP_007140090.1| hypothetical protein PHAVU_008G083500g [Phas... 64 3e-08 ref|XP_003533639.2| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_006339440.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_003623723.1| Pentatricopeptide repeat-containing protein ... 63 5e-08 ref|XP_004229820.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_004134345.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_003552343.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006445236.1| hypothetical protein CICLE_v10020287mg [Citr... 61 1e-07 ref|XP_002511731.1| pentatricopeptide repeat-containing protein,... 61 2e-07 ref|XP_004306911.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 gb|EYU22395.1| hypothetical protein MIMGU_mgv1a010291mg [Mimulus... 58 2e-06 ref|XP_006418475.1| hypothetical protein EUTSA_v10007755mg [Eutr... 56 6e-06 >emb|CBI38862.3| unnamed protein product [Vitis vinifera] Length = 353 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF E LS LL+AWV IMKPRRADWLSVLKEL RL+HPL EV Sbjct: 46 CFSPEERSLSDLLAAWVKIMKPRRADWLSVLKELGRLDHPLLLEV 90 >ref|XP_002273719.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Vitis vinifera] Length = 352 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF E LS LL+AWV IMKPRRADWLSVLKEL RL+HPL EV Sbjct: 46 CFSPEERSLSDLLAAWVKIMKPRRADWLSVLKELGRLDHPLLLEV 90 >ref|XP_007052035.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508704296|gb|EOX96192.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 420 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF E+ L+ LL+AWV IMKPRRADWL VLKEL +EHPL+FEV Sbjct: 114 CFCPEKGSLADLLAAWVKIMKPRRADWLVVLKELKIMEHPLYFEV 158 >gb|AFK47264.1| unknown [Lotus japonicus] Length = 414 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF AE+ ++S LL+AWV IMKP RA+WLSVLKEL +EHPL+ EV Sbjct: 113 CFSAEKGNVSDLLNAWVKIMKPIRAEWLSVLKELETMEHPLYLEV 157 >ref|XP_002320730.1| hypothetical protein POPTR_0014s06610g [Populus trichocarpa] gi|222861503|gb|EEE99045.1| hypothetical protein POPTR_0014s06610g [Populus trichocarpa] Length = 407 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF+ ++ L LLSAWV IMKPRR DWLS+LKEL ++EHPL+ EV Sbjct: 110 CFNDKKGSLRGLLSAWVKIMKPRRKDWLSILKELNKMEHPLYLEV 154 >ref|XP_004492640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like isoform X1 [Cicer arietinum] gi|502104764|ref|XP_004492641.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like isoform X2 [Cicer arietinum] Length = 425 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/71 (47%), Positives = 43/71 (60%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEVCFAASFSWCLASLDP 181 CF AE+ +L +L AWV IMKP RADWLSVLKEL ++HPL EV A + S +P Sbjct: 124 CFSAEKGNLCDVLGAWVKIMKPTRADWLSVLKELKNMDHPLHLEV---AEHALLEESFEP 180 Query: 182 SRHQSPKEKHH 214 + K H+ Sbjct: 181 NLRDYTKLIHY 191 >ref|XP_007140011.1| hypothetical protein PHAVU_008G076800g [Phaseolus vulgaris] gi|593337615|ref|XP_007140012.1| hypothetical protein PHAVU_008G076800g [Phaseolus vulgaris] gi|561013144|gb|ESW12005.1| hypothetical protein PHAVU_008G076800g [Phaseolus vulgaris] gi|561013145|gb|ESW12006.1| hypothetical protein PHAVU_008G076800g [Phaseolus vulgaris] Length = 409 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF AE+ +S LL +WV IM P RADWLS+LKEL+ +EHPL+ EV Sbjct: 108 CFSAEKGTISDLLESWVRIMNPIRADWLSILKELSIMEHPLYLEV 152 >gb|EXB52663.1| hypothetical protein L484_022440 [Morus notabilis] Length = 406 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/49 (53%), Positives = 39/49 (79%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEVCFAA 148 CF A ++ L+ LL+AWV IMKP+RADWL+++K+L ++HPL+F+V A Sbjct: 100 CFSAHKASLNELLAAWVRIMKPQRADWLAIIKQLKIMDHPLYFQVAEVA 148 >ref|XP_007140090.1| hypothetical protein PHAVU_008G083500g [Phaseolus vulgaris] gi|561013223|gb|ESW12084.1| hypothetical protein PHAVU_008G083500g [Phaseolus vulgaris] Length = 409 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF AE+ +S LL +WV IM P RADWLSVLKEL +EHPL+ EV Sbjct: 108 CFSAEKGTISDLLESWVRIMNPIRADWLSVLKELRIMEHPLYLEV 152 >ref|XP_003533639.2| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Glycine max] Length = 415 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF AE+ +S LL +WV +MKP RADWLSVLKEL EHP + EV Sbjct: 113 CFSAEKGTISDLLRSWVKLMKPTRADWLSVLKELRTTEHPFYLEV 157 >ref|XP_006339440.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Solanum tuberosum] Length = 415 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 C+ E+ +S LL AWV MKP RADWL+VLKEL RL HP++ EV Sbjct: 113 CYSPEKGSVSLLLEAWVKSMKPERADWLAVLKELDRLNHPMYLEV 157 >ref|XP_003623723.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498738|gb|AES79941.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 426 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/71 (46%), Positives = 42/71 (59%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEVCFAASFSWCLASLDP 181 CF E+ L +L AWV IMKP RADWLSVLKEL ++HPL+ EV A + S +P Sbjct: 123 CFSEEKGRLCDVLRAWVEIMKPTRADWLSVLKELKNMDHPLYLEV---AEHALVEESFEP 179 Query: 182 SRHQSPKEKHH 214 + K H+ Sbjct: 180 NLRDYTKLIHY 190 >ref|XP_004229820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Solanum lycopersicum] Length = 415 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 C+ E+ +S LL AWV MKP RADWL+VLKEL RL HP++ EV Sbjct: 113 CYSPEKGSVSLLLEAWVKSMKPDRADWLAVLKELDRLNHPMYLEV 157 >ref|XP_004134345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] gi|449480346|ref|XP_004155867.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Cucumis sativus] Length = 404 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEVCFAA 148 CF ++ +LS +L+AWV IMKP RADWL VLK L L HPL+ +V AA Sbjct: 103 CFSPQKGELSDMLAAWVRIMKPERADWLLVLKHLRILNHPLYIQVAEAA 151 >ref|XP_003552343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like isoform X1 [Glycine max] gi|571548118|ref|XP_006602756.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like isoform X2 [Glycine max] Length = 414 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 C+ AE+ +S LL +WV +MKP RADWLSVLKEL EHP++ EV Sbjct: 113 CYSAEKGSMSDLLRSWVKLMKPTRADWLSVLKELKIREHPVYLEV 157 >ref|XP_006445236.1| hypothetical protein CICLE_v10020287mg [Citrus clementina] gi|568875716|ref|XP_006490938.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Citrus sinensis] gi|557547498|gb|ESR58476.1| hypothetical protein CICLE_v10020287mg [Citrus clementina] Length = 423 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 C E +LS LL+AWV MKPRRADWL+VLK+L +EHPL+ +V Sbjct: 112 CVSPETGNLSDLLAAWVRFMKPRRADWLAVLKQLKLMEHPLYLQV 156 >ref|XP_002511731.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548911|gb|EEF50400.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 244 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 14 ERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 + + LS LLS+WV IMKPRR DWLSVLK+L +EHPL+ EV Sbjct: 115 QNASLSDLLSSWVRIMKPRRTDWLSVLKQLKNMEHPLYLEV 155 >ref|XP_004306911.1| PREDICTED: pentatricopeptide repeat-containing protein At1g01970-like [Fragaria vesca subsp. vesca] Length = 415 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF E+ L +L+AWV IMKP RADWL+VLKEL +HPL+ +V Sbjct: 109 CFAPEKGSLCEVLNAWVSIMKPSRADWLAVLKELRIKDHPLYLQV 153 >gb|EYU22395.1| hypothetical protein MIMGU_mgv1a010291mg [Mimulus guttatus] Length = 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEV 136 CF E + +L+AWV PRR DWLSV KEL L HPL+FEV Sbjct: 14 CFSPENGSVPLMLAAWVKSTNPRRTDWLSVFKELEALNHPLYFEV 58 >ref|XP_006418475.1| hypothetical protein EUTSA_v10007755mg [Eutrema salsugineum] gi|557096246|gb|ESQ36828.1| hypothetical protein EUTSA_v10007755mg [Eutrema salsugineum] Length = 414 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/71 (43%), Positives = 40/71 (56%) Frame = +2 Query: 2 CFDAERSDLSCLLSAWVGIMKPRRADWLSVLKELARLEHPLFFEVCFAASFSWCLASLDP 181 CF E+ + LL+AWV MKP RADWLS+LKEL LE P + +V A FS S + Sbjct: 112 CFSREKGSVCDLLAAWVRRMKPIRADWLSLLKELKNLESPFYIKV---AEFSLLEDSFEA 168 Query: 182 SRHQSPKEKHH 214 + K H+ Sbjct: 169 NARDYTKIIHY 179