BLASTX nr result
ID: Sinomenium21_contig00028000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00028000 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161622.1| hypothetical protein PHAVU_001G0849001g, par... 60 3e-07 ref|XP_007215332.1| hypothetical protein PRUPE_ppa005273mg [Prun... 58 1e-06 emb|CAJ44461.1| sialyltransferase like protein [Aquilegia formos... 57 3e-06 >ref|XP_007161622.1| hypothetical protein PHAVU_001G0849001g, partial [Phaseolus vulgaris] gi|561035086|gb|ESW33616.1| hypothetical protein PHAVU_001G0849001g, partial [Phaseolus vulgaris] Length = 248 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = -3 Query: 156 ASAKRQPTVLLLVCSAVFFSLIVLAIQTSFFTGSRKFDVNSEDVLILSDFQA 1 ++ R+PTVL LVC+A FFSL++ IQ+SFF GS D NSE + +LS+FQ+ Sbjct: 8 SALNRRPTVLYLVCAAAFFSLLLFYIQSSFFAGSLSSDRNSESIRVLSNFQS 59 >ref|XP_007215332.1| hypothetical protein PRUPE_ppa005273mg [Prunus persica] gi|462411482|gb|EMJ16531.1| hypothetical protein PRUPE_ppa005273mg [Prunus persica] Length = 469 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/50 (56%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -3 Query: 144 RQPTVLLLVCSAVFFSLIVLAIQTSFFTGSRKFDVNSE--DVLILSDFQA 1 R+PTVL LVC+A FFS+++ IQ+S FTG++K D+ +E DV ILS+FQ+ Sbjct: 14 RRPTVLYLVCAAAFFSVLLFGIQSSLFTGNQKLDLKTEQQDVRILSEFQS 63 >emb|CAJ44461.1| sialyltransferase like protein [Aquilegia formosa x Aquilegia pubescens] Length = 476 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/62 (54%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = -3 Query: 174 MLKPLKASA----KRQPTVLLLVCSAVFFSLIVLAIQTSFFTGSRKFDVNSEDVLILSDF 7 ML+PLKASA +R TVLLLV AV FSL+VL IQTS FTG++ ++ +E + IL++F Sbjct: 1 MLRPLKASAANNQRRPITVLLLVFCAVVFSLLVLIIQTS-FTGNQNHNIKAETIQILTNF 59 Query: 6 QA 1 Q+ Sbjct: 60 QS 61