BLASTX nr result
ID: Sinomenium21_contig00027986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027986 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843581.1| hypothetical protein AMTR_s00007p00111990 [A... 64 3e-08 ref|XP_004238017.1| PREDICTED: transcription initiation factor T... 60 3e-07 ref|XP_002531250.1| transcription factor, putative [Ricinus comm... 60 3e-07 ref|XP_003601644.1| Transcription initiation factor TFIID subuni... 60 3e-07 ref|XP_006591593.1| PREDICTED: transcription initiation factor T... 60 4e-07 ref|XP_004172889.1| PREDICTED: transcription initiation factor T... 59 5e-07 ref|XP_004142764.1| PREDICTED: transcription initiation factor T... 59 5e-07 ref|XP_002304864.1| TATA-binding protein-associated factor TAFII... 59 5e-07 ref|NP_001275612.1| uncharacterized protein LOC102594176 [Solanu... 59 7e-07 ref|XP_007014683.1| TBP-associated factor 7 isoform 5 [Theobroma... 59 9e-07 ref|XP_002299114.2| hypothetical protein POPTR_0001s04340g [Popu... 58 1e-06 ref|XP_007161275.1| hypothetical protein PHAVU_001G056600g [Phas... 58 2e-06 ref|XP_002285704.2| PREDICTED: transcription initiation factor T... 58 2e-06 ref|XP_006581030.1| PREDICTED: uncharacterized protein LOC100806... 58 2e-06 ref|XP_003544704.1| PREDICTED: transcription initiation factor T... 58 2e-06 ref|NP_001242881.1| uncharacterized protein LOC100782843 [Glycin... 58 2e-06 ref|XP_007014679.1| TBP-associated factor 7 isoform 1 [Theobroma... 57 4e-06 ref|XP_004502223.1| PREDICTED: transcription initiation factor T... 57 4e-06 gb|ABR18236.1| unknown [Picea sitchensis] 57 4e-06 ref|XP_007161274.1| hypothetical protein PHAVU_001G056500g [Phas... 56 5e-06 >ref|XP_006843581.1| hypothetical protein AMTR_s00007p00111990 [Amborella trichopoda] gi|548845949|gb|ERN05256.1| hypothetical protein AMTR_s00007p00111990 [Amborella trichopoda] Length = 249 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDILF 102 RREPDLNPELV RVE+DL++IMAGGTAENVDILF Sbjct: 127 RREPDLNPELVQRVERDLLSIMAGGTAENVDILF 160 >ref|XP_004238017.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Solanum lycopersicum] Length = 197 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL NIM+GGTAEN+DI Sbjct: 115 RREPDLNPELVRRVEKDLQNIMSGGTAENIDI 146 >ref|XP_002531250.1| transcription factor, putative [Ricinus communis] gi|223529135|gb|EEF31114.1| transcription factor, putative [Ricinus communis] Length = 175 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDILFILCCAL 120 RREPDLNPELV RVE+DL+NIMAG T EN DIL + CC L Sbjct: 80 RREPDLNPELVRRVERDLLNIMAGVTVENADIL-LYCCHL 118 >ref|XP_003601644.1| Transcription initiation factor TFIID subunit [Medicago truncatula] gi|355490692|gb|AES71895.1| Transcription initiation factor TFIID subunit [Medicago truncatula] Length = 206 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDIL 99 RREPDLNPELV RVEKDL+ I+AGGTAEN+DIL Sbjct: 118 RREPDLNPELVSRVEKDLLKIIAGGTAENIDIL 150 >ref|XP_006591593.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Glycine max] Length = 251 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDIL 99 RREPDLNPELV RVEKDL+ IMAGGTA+N+DIL Sbjct: 119 RREPDLNPELVSRVEKDLLKIMAGGTADNLDIL 151 >ref|XP_004172889.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Cucumis sativus] Length = 201 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL+NIMAGGT EN D+ Sbjct: 117 RREPDLNPELVRRVEKDLLNIMAGGTTENADV 148 >ref|XP_004142764.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Cucumis sativus] Length = 201 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL+NIMAGGT EN D+ Sbjct: 117 RREPDLNPELVRRVEKDLLNIMAGGTTENADV 148 >ref|XP_002304864.1| TATA-binding protein-associated factor TAFII55 [Populus trichocarpa] gi|222842296|gb|EEE79843.1| TATA-binding protein-associated factor TAFII55 [Populus trichocarpa] Length = 161 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDILFIL 108 RREP LNPELV RVEKDL+NIMAGGT EN DIL I+ Sbjct: 117 RREPYLNPELVQRVEKDLLNIMAGGTVENADILSIM 152 >ref|NP_001275612.1| uncharacterized protein LOC102594176 [Solanum tuberosum] gi|77416967|gb|ABA81879.1| unknown [Solanum tuberosum] Length = 197 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RV+KDL NIM+GGTAEN+DI Sbjct: 115 RREPDLNPELVRRVDKDLQNIMSGGTAENIDI 146 >ref|XP_007014683.1| TBP-associated factor 7 isoform 5 [Theobroma cacao] gi|508785046|gb|EOY32302.1| TBP-associated factor 7 isoform 5 [Theobroma cacao] Length = 210 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDIL 99 RREPDLNPELV RVEKDLVNIM+GGT E++D+L Sbjct: 117 RREPDLNPELVQRVEKDLVNIMSGGTVESLDML 149 >ref|XP_002299114.2| hypothetical protein POPTR_0001s04340g [Populus trichocarpa] gi|550346491|gb|EEE83919.2| hypothetical protein POPTR_0001s04340g [Populus trichocarpa] Length = 200 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVD 93 RREPDLNPELV RVEKDL+NIMAGGT EN D Sbjct: 117 RREPDLNPELVQRVEKDLLNIMAGGTVENAD 147 >ref|XP_007161275.1| hypothetical protein PHAVU_001G056600g [Phaseolus vulgaris] gi|561034739|gb|ESW33269.1| hypothetical protein PHAVU_001G056600g [Phaseolus vulgaris] Length = 199 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVD 93 RREPDLNPELV RVEKDL+ IMAGGTAEN+D Sbjct: 118 RREPDLNPELVSRVEKDLLKIMAGGTAENLD 148 >ref|XP_002285704.2| PREDICTED: transcription initiation factor TFIID subunit 7-like [Vitis vinifera] Length = 205 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENV 90 RREPDLNPELV RVE+DL+NIMAGGTAENV Sbjct: 126 RREPDLNPELVRRVERDLLNIMAGGTAENV 155 >ref|XP_006581030.1| PREDICTED: uncharacterized protein LOC100806004 isoform X1 [Glycine max] gi|571458086|ref|XP_006581031.1| PREDICTED: uncharacterized protein LOC100806004 isoform X2 [Glycine max] gi|571458088|ref|XP_006581032.1| PREDICTED: uncharacterized protein LOC100806004 isoform X3 [Glycine max] gi|571458090|ref|XP_006581033.1| PREDICTED: uncharacterized protein LOC100806004 isoform X4 [Glycine max] Length = 200 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL+ IMAGGTA+N+D+ Sbjct: 118 RREPDLNPELVSRVEKDLLKIMAGGTADNLDV 149 >ref|XP_003544704.1| PREDICTED: transcription initiation factor TFIID subunit 7-like [Glycine max] Length = 200 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL+ IMAGGTA+N+D+ Sbjct: 118 RREPDLNPELVSRVEKDLLKIMAGGTADNLDV 149 >ref|NP_001242881.1| uncharacterized protein LOC100782843 [Glycine max] gi|255628987|gb|ACU14838.1| unknown [Glycine max] Length = 200 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPELV RVEKDL+ IMAGGTA+N+D+ Sbjct: 118 RREPDLNPELVSRVEKDLLKIMAGGTADNLDV 149 >ref|XP_007014679.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582645|ref|XP_007014680.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582648|ref|XP_007014681.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|590582652|ref|XP_007014682.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785042|gb|EOY32298.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785043|gb|EOY32299.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785044|gb|EOY32300.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] gi|508785045|gb|EOY32301.1| TBP-associated factor 7 isoform 1 [Theobroma cacao] Length = 200 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVD 93 RREPDLNPELV RVEKDLVNIM+GGT E++D Sbjct: 117 RREPDLNPELVQRVEKDLVNIMSGGTVESLD 147 >ref|XP_004502223.1| PREDICTED: transcription initiation factor TFIID subunit 7-like isoform X1 [Cicer arietinum] Length = 206 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDIL 99 RREPDLNPELV RVEKDL+ I+AGGT +N+DIL Sbjct: 118 RREPDLNPELVSRVEKDLLKIIAGGTVDNLDIL 150 >gb|ABR18236.1| unknown [Picea sitchensis] Length = 205 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVDI 96 RREPDLNPE+V RVEKD+++IMAGGTA NVD+ Sbjct: 117 RREPDLNPEIVHRVEKDIMSIMAGGTAHNVDV 148 >ref|XP_007161274.1| hypothetical protein PHAVU_001G056500g [Phaseolus vulgaris] gi|561034738|gb|ESW33268.1| hypothetical protein PHAVU_001G056500g [Phaseolus vulgaris] Length = 199 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 RREPDLNPELVLRVEKDLVNIMAGGTAENVD 93 RREPDLNPELV RVEKDL+ IMAGGTAEN D Sbjct: 118 RREPDLNPELVSRVEKDLLKIMAGGTAENHD 148