BLASTX nr result
ID: Sinomenium21_contig00027865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027865 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325013.2| hypothetical protein POPTR_0018s09160g [Popu... 56 6e-06 >ref|XP_002325013.2| hypothetical protein POPTR_0018s09160g [Populus trichocarpa] gi|550318370|gb|EEF03578.2| hypothetical protein POPTR_0018s09160g [Populus trichocarpa] Length = 332 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -1 Query: 491 FREILLDKIGFRTVENIAARLPGSAAGFDRPIFAFRK 381 FREILLDKIGFR VE+I L GS AGFDRPIF + K Sbjct: 296 FREILLDKIGFRRVEDITDGLSGSKAGFDRPIFVYHK 332