BLASTX nr result
ID: Sinomenium21_contig00027846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027846 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [A... 71 2e-10 gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Mimulus... 70 4e-10 ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic su... 70 4e-10 ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic su... 70 4e-10 ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic su... 70 4e-10 gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium h... 70 4e-10 gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium g... 70 4e-10 gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium a... 70 4e-10 gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium d... 70 4e-10 gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium a... 70 4e-10 gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium h... 70 4e-10 gb|AEP33550.1| truncated cellulose synthase catalytic subunit [G... 70 4e-10 gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium b... 70 4e-10 gb|AEP33544.1| truncated cellulose synthase catalytic subunit [G... 70 4e-10 gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium d... 70 4e-10 gb|AEP33542.1| truncated cellulose synthase catalytic subunit [G... 70 4e-10 gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium m... 70 4e-10 gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium m... 70 4e-10 gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium s... 70 4e-10 gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium l... 70 4e-10 >ref|XP_006838305.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda] gi|548840773|gb|ERN00874.1| hypothetical protein AMTR_s00103p00124340 [Amborella trichopoda] Length = 1088 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC Sbjct: 1057 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 1088 >gb|EYU29030.1| hypothetical protein MIMGU_mgv1a000570mg [Mimulus guttatus] Length = 1065 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1034 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1065 >ref|XP_003533898.2| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X1 [Glycine max] gi|571477127|ref|XP_006587173.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like isoform X2 [Glycine max] Length = 1074 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1043 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1074 >ref|XP_004162186.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1070 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1039 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1070 >ref|XP_004149389.1| PREDICTED: cellulose synthase A catalytic subunit 3 [UDP-forming]-like [Cucumis sativus] Length = 1050 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1019 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1050 >gb|AAD39534.2| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33557.1| cellulose synthase catalytic subunit [Gossypium gossypioides] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33556.1| cellulose synthase catalytic subunit [Gossypium aridum] gi|347953865|gb|AEP33558.1| cellulose synthase catalytic subunit [Gossypium lobatum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33554.1| cellulose synthase catalytic subunit [Gossypium davidsonii] gi|347953859|gb|AEP33555.1| cellulose synthase catalytic subunit [Gossypium klotzschianum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33552.1| cellulose synthase catalytic subunit [Gossypium armourianum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33551.1| cellulose synthase catalytic subunit [Gossypium hirsutum subsp. latifolium] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33550.1| truncated cellulose synthase catalytic subunit [Gossypium hirsutum subsp. latifolium] Length = 684 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 653 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 684 >gb|AEP33547.1| cellulose synthase catalytic subunit [Gossypium barbadense var. brasiliense] gi|347953847|gb|AEP33549.1| cellulose synthase catalytic subunit [Gossypium barbadense var. peruvianum] Length = 1066 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1035 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1066 >gb|AEP33544.1| truncated cellulose synthase catalytic subunit [Gossypium tomentosum] Length = 684 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 653 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 684 >gb|AEP33543.1| cellulose synthase catalytic subunit [Gossypium darwinii] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33542.1| truncated cellulose synthase catalytic subunit [Gossypium darwinii] gi|347953841|gb|AEP33546.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense var. brasiliense] gi|347953845|gb|AEP33548.1| truncated cellulose synthase catalytic subunit [Gossypium barbadense var. peruvianum] Length = 684 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 653 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 684 >gb|AEP33541.1| cellulose synthase catalytic subunit [Gossypium mustelinum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33540.1| cellulose synthase catalytic subunit [Gossypium mustelinum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33538.1| cellulose synthase catalytic subunit [Gossypium schwendimanii] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067 >gb|AEP33537.1| cellulose synthase catalytic subunit [Gossypium laxum] Length = 1067 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LLASIFSLLWVRIDPFTTRVTGPDVQQCGINC 97 LLASIFSLLWVRIDPFTTRVTGPDV+QCGINC Sbjct: 1036 LLASIFSLLWVRIDPFTTRVTGPDVEQCGINC 1067