BLASTX nr result
ID: Sinomenium21_contig00027447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027447 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67898.1| Soluble inorganic pyrophosphatase [Morus notabilis] 55 8e-06 >gb|EXB67898.1| Soluble inorganic pyrophosphatase [Morus notabilis] Length = 272 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/84 (42%), Positives = 50/84 (59%), Gaps = 2/84 (2%) Frame = +2 Query: 41 WISLLFFA-FHLRFCSTVVVLFGVQIEGAESFASVNFKVRFQ-LAIMAPPIETPNATSDL 214 ++SLL F L ++++ V + + SFA R L +MAPPIETP+ Sbjct: 11 YLSLLSFVRAPLSLSLSLLLEICVSLPSSLSFAGEGLVPRTSSLPVMAPPIETPHNIPGS 70 Query: 215 DRSHCPPLNERILSSLSQRAVAAH 286 R+ PPLNERILSS+S+R+VAAH Sbjct: 71 KRASHPPLNERILSSMSRRSVAAH 94