BLASTX nr result
ID: Sinomenium21_contig00027337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027337 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143616.1| PREDICTED: exosome complex component RRP41-l... 65 1e-08 ref|XP_002280302.1| PREDICTED: exosome complex component RRP41 [... 64 3e-08 ref|XP_007051637.1| 3'-5'-exoribonuclease family protein isoform... 63 5e-08 ref|XP_007051636.1| 3'-5'-exoribonuclease family protein isoform... 63 5e-08 ref|XP_004494791.1| PREDICTED: exosome complex component RRP41-l... 63 5e-08 ref|XP_004494789.1| PREDICTED: exosome complex component RRP41-l... 63 5e-08 gb|AFK39498.1| unknown [Medicago truncatula] 63 5e-08 ref|XP_003626533.1| Exosome complex exonuclease RRP41 [Medicago ... 63 5e-08 gb|ADE77635.1| unknown [Picea sitchensis] 63 5e-08 gb|EMT23869.1| Exosome complex exonuclease RRP41 [Aegilops tausc... 62 6e-08 ref|XP_002320845.1| exonuclease RRP41 family protein [Populus tr... 61 1e-07 ref|XP_003567917.1| PREDICTED: exosome complex component RRP41-l... 61 2e-07 ref|XP_003549686.1| PREDICTED: exosome complex component RRP41 i... 61 2e-07 ref|XP_002530509.1| Exosome complex exonuclease RRP41, putative ... 61 2e-07 ref|XP_007147271.1| hypothetical protein PHAVU_006G109900g [Phas... 60 2e-07 ref|XP_006660459.1| PREDICTED: exosome complex component RRP41-l... 60 4e-07 ref|XP_006655159.1| PREDICTED: exosome complex component RRP41-l... 60 4e-07 gb|EEC84173.1| hypothetical protein OsI_30553 [Oryza sativa Indi... 60 4e-07 ref|XP_003554748.1| PREDICTED: exosome complex component RRP41-l... 58 1e-06 ref|XP_006443538.1| hypothetical protein CICLE_v10021944mg [Citr... 57 2e-06 >ref|XP_004143616.1| PREDICTED: exosome complex component RRP41-like [Cucumis sativus] gi|449516461|ref|XP_004165265.1| PREDICTED: exosome complex component RRP41-like [Cucumis sativus] Length = 241 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP+DVFE VMELA EGCKA+A YI+NV+LEHTKQ Sbjct: 198 DAKLPIDVFEDVMELAIEGCKAIATYIRNVMLEHTKQ 234 >ref|XP_002280302.1| PREDICTED: exosome complex component RRP41 [Vitis vinifera] gi|147867252|emb|CAN81194.1| hypothetical protein VITISV_022853 [Vitis vinifera] gi|297745390|emb|CBI40470.3| unnamed protein product [Vitis vinifera] Length = 241 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD+FE+VM+LA EGCKA+ANYI+ VLLE+TKQ Sbjct: 198 DAKLPMDIFENVMQLAIEGCKAIANYIREVLLENTKQ 234 >ref|XP_007051637.1| 3'-5'-exoribonuclease family protein isoform 2 [Theobroma cacao] gi|508703898|gb|EOX95794.1| 3'-5'-exoribonuclease family protein isoform 2 [Theobroma cacao] Length = 241 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP+D+FE+VM LATEGCKA+ANYI+ VLLE+TKQ Sbjct: 198 DAKLPLDIFENVMGLATEGCKAVANYIREVLLENTKQ 234 >ref|XP_007051636.1| 3'-5'-exoribonuclease family protein isoform 1 [Theobroma cacao] gi|508703897|gb|EOX95793.1| 3'-5'-exoribonuclease family protein isoform 1 [Theobroma cacao] Length = 316 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP+D+FE+VM LATEGCKA+ANYI+ VLLE+TKQ Sbjct: 273 DAKLPLDIFENVMGLATEGCKAVANYIREVLLENTKQ 309 >ref|XP_004494791.1| PREDICTED: exosome complex component RRP41-like isoform X3 [Cicer arietinum] Length = 223 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LATEGCKA+ANYI+ +LLE+TKQ Sbjct: 180 DSKLPVDILENVMQLATEGCKAIANYIREILLENTKQ 216 >ref|XP_004494789.1| PREDICTED: exosome complex component RRP41-like isoform X1 [Cicer arietinum] gi|502113882|ref|XP_004494790.1| PREDICTED: exosome complex component RRP41-like isoform X2 [Cicer arietinum] Length = 241 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LATEGCKA+ANYI+ +LLE+TKQ Sbjct: 198 DSKLPVDILENVMQLATEGCKAIANYIREILLENTKQ 234 >gb|AFK39498.1| unknown [Medicago truncatula] Length = 180 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LATEGCKA+ANYI+ +LLE+TKQ Sbjct: 137 DSKLPIDILENVMQLATEGCKAIANYIREILLENTKQ 173 >ref|XP_003626533.1| Exosome complex exonuclease RRP41 [Medicago truncatula] gi|355501548|gb|AES82751.1| Exosome complex exonuclease RRP41 [Medicago truncatula] Length = 241 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LATEGCKA+ANYI+ +LLE+TKQ Sbjct: 198 DSKLPIDILENVMQLATEGCKAIANYIREILLENTKQ 234 >gb|ADE77635.1| unknown [Picea sitchensis] Length = 243 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLPMD+FE+VM+LA EGCKA+ YIQ+VLLE+TKQ Sbjct: 198 DSKLPMDIFETVMQLAIEGCKAIVRYIQDVLLENTKQ 234 >gb|EMT23869.1| Exosome complex exonuclease RRP41 [Aegilops tauschii] Length = 223 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD FE+VM+LATEGCKA+A YI+ VLLE+TKQ Sbjct: 181 DAKLPMDTFETVMDLATEGCKAIATYIREVLLENTKQ 217 >ref|XP_002320845.1| exonuclease RRP41 family protein [Populus trichocarpa] gi|118489833|gb|ABK96716.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861618|gb|EEE99160.1| exonuclease RRP41 family protein [Populus trichocarpa] Length = 241 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP+D FE+VM+LA EGCKA+ANYI+ VLLE+TKQ Sbjct: 198 DAKLPIDTFENVMQLAVEGCKAIANYIREVLLENTKQ 234 >ref|XP_003567917.1| PREDICTED: exosome complex component RRP41-like [Brachypodium distachyon] Length = 242 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD FE+VMELA EGCKA+A YI+ +LLE+TKQ Sbjct: 200 DAKLPMDTFETVMELAIEGCKAIATYIREILLENTKQ 236 >ref|XP_003549686.1| PREDICTED: exosome complex component RRP41 isoform X1 [Glycine max] gi|571535380|ref|XP_006600700.1| PREDICTED: exosome complex component RRP41 isoform X2 [Glycine max] Length = 241 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LA EGCKA+ANYI+ VLLE+TKQ Sbjct: 198 DSKLPIDILENVMQLAIEGCKAIANYIREVLLENTKQ 234 >ref|XP_002530509.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] gi|223529966|gb|EEF31893.1| Exosome complex exonuclease RRP41, putative [Ricinus communis] Length = 241 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP+D FE+VM+LA EGCKA+ANYI+ +LLE+TKQ Sbjct: 198 DAKLPIDTFENVMQLAVEGCKAIANYIREILLENTKQ 234 >ref|XP_007147271.1| hypothetical protein PHAVU_006G109900g [Phaseolus vulgaris] gi|561020494|gb|ESW19265.1| hypothetical protein PHAVU_006G109900g [Phaseolus vulgaris] Length = 240 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LA EGCKA+ANYI+ +LLE+TKQ Sbjct: 197 DSKLPIDILETVMQLAIEGCKAIANYIREILLENTKQ 233 >ref|XP_006660459.1| PREDICTED: exosome complex component RRP41-like isoform X1 [Oryza brachyantha] gi|573956455|ref|XP_006660460.1| PREDICTED: exosome complex component RRP41-like isoform X2 [Oryza brachyantha] gi|573956457|ref|XP_006660461.1| PREDICTED: exosome complex component RRP41-like isoform X3 [Oryza brachyantha] Length = 223 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD FE+VMELA EGCKA+A YI+ VLLE+TK+ Sbjct: 181 DAKLPMDTFETVMELAIEGCKAIAKYIREVLLENTKR 217 >ref|XP_006655159.1| PREDICTED: exosome complex component RRP41-like [Oryza brachyantha] Length = 266 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD FE+VMELA EGCKA+A YI+ VLLE+TK+ Sbjct: 224 DAKLPMDTFETVMELAIEGCKAIAKYIREVLLENTKR 260 >gb|EEC84173.1| hypothetical protein OsI_30553 [Oryza sativa Indica Group] gi|222641142|gb|EEE69274.1| hypothetical protein OsJ_28540 [Oryza sativa Japonica Group] Length = 242 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLPMD FE+VM+LA EGCKA+ANYI+ VLLE+T++ Sbjct: 200 DAKLPMDTFETVMDLAIEGCKAIANYIREVLLENTRR 236 >ref|XP_003554748.1| PREDICTED: exosome complex component RRP41-like [Glycine max] Length = 241 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 DSKLP+D+ E+VM+LA EGCKA+ANYI+ +LL +TKQ Sbjct: 198 DSKLPIDILENVMQLAIEGCKAIANYIREILLANTKQ 234 >ref|XP_006443538.1| hypothetical protein CICLE_v10021944mg [Citrus clementina] gi|568851047|ref|XP_006479205.1| PREDICTED: exosome complex component RRP41-like isoform X1 [Citrus sinensis] gi|568851049|ref|XP_006479206.1| PREDICTED: exosome complex component RRP41-like isoform X2 [Citrus sinensis] gi|557545800|gb|ESR56778.1| hypothetical protein CICLE_v10021944mg [Citrus clementina] Length = 241 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 5 DSKLPMDVFESVMELATEGCKALANYIQNVLLEHTKQ 115 D+KLP + FE VM+LA EGCKA+ANYI+ VLLE+TKQ Sbjct: 198 DAKLPTNTFEDVMQLAIEGCKAVANYIREVLLENTKQ 234