BLASTX nr result
ID: Sinomenium21_contig00027115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027115 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004496778.1| PREDICTED: pyruvate, phosphate dikinase regu... 57 3e-06 >ref|XP_004496778.1| PREDICTED: pyruvate, phosphate dikinase regulatory protein 1, chloroplastic-like [Cicer arietinum] Length = 380 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +3 Query: 99 NNHNTHNAESQKLKASPKLNRWYRARSIRAGRRLNRPSSRTHTIEPAPVRP 251 NN + ++K K SP+LNRW RAR+IR+G +L+R SSRT T+EP +P Sbjct: 20 NNETGSKSVTRKTKVSPQLNRWSRARAIRSGHKLDRSSSRTQTLEPNHSQP 70