BLASTX nr result
ID: Sinomenium21_contig00027057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00027057 (757 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp.... 56 5e-07 >ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297334222|gb|EFH64640.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 50 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 579 GSDHRKNSPQANQPILCMGFTRWLEQRHIWL 671 G DHRK+S + NQPI CMG T+WLEQRHIWL Sbjct: 20 GYDHRKDSLKVNQPIPCMGLTQWLEQRHIWL 50 Score = 25.0 bits (53), Expect(2) = 5e-07 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 527 HHSFYWILRSLFMHGMI 577 H YWILRS +HG + Sbjct: 3 HPLIYWILRSPLIHGSV 19