BLASTX nr result
ID: Sinomenium21_contig00026967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026967 (551 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284039.1| PREDICTED: sulfhydryl oxidase 2 [Vitis vinif... 67 4e-09 gb|EXB65608.1| Sulfhydryl oxidase 2 [Morus notabilis] 65 1e-08 ref|XP_006837220.1| hypothetical protein AMTR_s00105p00128850 [A... 61 2e-07 ref|XP_007225749.1| hypothetical protein PRUPE_ppa004371mg [Prun... 60 4e-07 ref|XP_006605324.1| PREDICTED: protein disulfide family pdiq-1a ... 59 6e-07 dbj|BAJ54084.1| protein disulfide isomerase family [Glycine max] 59 6e-07 ref|NP_001238440.1| protein disulfide family pdiq-1a precursor [... 59 6e-07 ref|XP_006360420.1| PREDICTED: sulfhydryl oxidase 2-like isoform... 58 1e-06 ref|XP_006360419.1| PREDICTED: sulfhydryl oxidase 2-like isoform... 58 1e-06 ref|NP_565258.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis thal... 58 2e-06 gb|AAK59679.1| unknown protein [Arabidopsis thaliana] 58 2e-06 ref|XP_004236967.1| PREDICTED: sulfhydryl oxidase 2-like isoform... 57 2e-06 ref|XP_004236966.1| PREDICTED: sulfhydryl oxidase 2-like isoform... 57 2e-06 ref|XP_006398514.1| hypothetical protein EUTSA_v10000862mg [Eutr... 57 4e-06 ref|XP_006290965.1| hypothetical protein CARUB_v10017079mg [Caps... 57 4e-06 ref|XP_002875066.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis l... 57 4e-06 ref|XP_002536486.1| protein disulfide-isomerase, putative [Ricin... 57 4e-06 ref|XP_002311489.1| thioredoxin family protein [Populus trichoca... 56 5e-06 >ref|XP_002284039.1| PREDICTED: sulfhydryl oxidase 2 [Vitis vinifera] gi|297737729|emb|CBI26930.3| unnamed protein product [Vitis vinifera] Length = 515 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 5/56 (8%) Frame = +3 Query: 399 ASSAPVGSRSILRAL-----SGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 +SS P+GSR ILRA+ +GPD DAA +LN+T+FD VL+ +PA++AIVEFFAH Sbjct: 18 SSSVPIGSRDILRAIDIDSNTGPDLHDAAVDLNTTNFDQVLRNTPATYAIVEFFAH 73 >gb|EXB65608.1| Sulfhydryl oxidase 2 [Morus notabilis] Length = 540 Score = 65.1 bits (157), Expect = 1e-08 Identities = 34/54 (62%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +3 Query: 396 TASSAPVGSRSILRALSGP--DPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 ++SSA +GSRSILRA+ G DP D A +LN T+FD VLK +PA+FA+VEFFAH Sbjct: 22 SSSSANMGSRSILRAIDGDNGDPRDYAVDLNVTNFDSVLKDTPATFAVVEFFAH 75 >ref|XP_006837220.1| hypothetical protein AMTR_s00105p00128850 [Amborella trichopoda] gi|548839817|gb|ERN00074.1| hypothetical protein AMTR_s00105p00128850 [Amborella trichopoda] Length = 508 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 420 SRSILRALSGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 SRS+LR++ DPPD A +LNS+DFD L SPAS+AIVEFFAH Sbjct: 33 SRSLLRSIDDQDPPDLAVDLNSSDFDRYLADSPASWAIVEFFAH 76 >ref|XP_007225749.1| hypothetical protein PRUPE_ppa004371mg [Prunus persica] gi|462422685|gb|EMJ26948.1| hypothetical protein PRUPE_ppa004371mg [Prunus persica] Length = 514 Score = 60.1 bits (144), Expect = 4e-07 Identities = 33/54 (61%), Positives = 42/54 (77%), Gaps = 2/54 (3%) Frame = +3 Query: 396 TASSAPVGSRSILRALS--GPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 +ASS+ GSRSILRA++ D D A ELN+T+FD VL+ +PASFA+VEFFAH Sbjct: 20 SASSSSWGSRSILRAVNTDNADVHDYAVELNATNFDEVLRDTPASFAVVEFFAH 73 >ref|XP_006605324.1| PREDICTED: protein disulfide family pdiq-1a isoform X1 [Glycine max] Length = 511 Score = 59.3 bits (142), Expect = 6e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = +3 Query: 399 ASSAPVGSRSILRALS-----GPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 +SS+ RSILR +S G D PD A ELN+T+FD VLK +PA+FA+VEFFAH Sbjct: 22 SSSSFASRRSILREVSDNGKSGGDHPDYAVELNATNFDAVLKETPATFAVVEFFAH 77 >dbj|BAJ54084.1| protein disulfide isomerase family [Glycine max] Length = 511 Score = 59.3 bits (142), Expect = 6e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = +3 Query: 399 ASSAPVGSRSILRALS-----GPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 +SS+ RSILR +S G D PD A ELN+T+FD VLK +PA+FA+VEFFAH Sbjct: 22 SSSSFASRRSILREVSDNGKSGGDHPDYAVELNATNFDAVLKETPATFAVVEFFAH 77 >ref|NP_001238440.1| protein disulfide family pdiq-1a precursor [Glycine max] gi|317175937|dbj|BAJ54083.1| protein disulfide family [Glycine max] Length = 516 Score = 59.3 bits (142), Expect = 6e-07 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = +3 Query: 399 ASSAPVGSRSILRALS-----GPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 +SS+ RSILR +S G D PD A ELN+T+FD VLK +PA+FA+VEFFAH Sbjct: 22 SSSSFASRRSILREVSDNGKSGGDHPDYAVELNATNFDAVLKETPATFAVVEFFAH 77 >ref|XP_006360420.1| PREDICTED: sulfhydryl oxidase 2-like isoform X2 [Solanum tuberosum] Length = 512 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +3 Query: 423 RSILRALSGPD--PPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 R ILRA+SG D PD A ELN+T+FD VLK +PA +AIVEFFAH Sbjct: 29 REILRAISGQDGEKPDFAVELNATNFDSVLKETPAPYAIVEFFAH 73 >ref|XP_006360419.1| PREDICTED: sulfhydryl oxidase 2-like isoform X1 [Solanum tuberosum] Length = 516 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +3 Query: 423 RSILRALSGPD--PPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 R ILRA+SG D PD A ELN+T+FD VLK +PA +AIVEFFAH Sbjct: 29 REILRAISGQDGEKPDFAVELNATNFDSVLKETPAPYAIVEFFAH 73 >ref|NP_565258.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis thaliana] gi|75339028|sp|Q9ZU40.2|QSOX2_ARATH RecName: Full=Sulfhydryl oxidase 2; AltName: Full=Quiescin-sulfhydryl oxidase 2; Short=AtQSOX2; Flags: Precursor gi|19699314|gb|AAL91267.1| At2g01270/F10A8.15 [Arabidopsis thaliana] gi|20197588|gb|AAD14527.2| expressed protein [Arabidopsis thaliana] gi|21928041|gb|AAM78049.1| At2g01270/F10A8.15 [Arabidopsis thaliana] gi|24030200|gb|AAN41280.1| unknown protein [Arabidopsis thaliana] gi|330250331|gb|AEC05425.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis thaliana] Length = 495 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 ASS+ GSR ILR +S D D A ELN+T+FD VLK +PA +A+VEFFAH Sbjct: 16 ASSSSPGSRLILREIS--DQKDKAVELNTTNFDSVLKDTPAKYAVVEFFAH 64 >gb|AAK59679.1| unknown protein [Arabidopsis thaliana] Length = 495 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 ASS+ GSR ILR +S D D A ELN+T+FD VLK +PA +A+VEFFAH Sbjct: 16 ASSSSPGSRLILREIS--DQKDKAVELNTTNFDSVLKDTPAKYAVVEFFAH 64 >ref|XP_004236967.1| PREDICTED: sulfhydryl oxidase 2-like isoform 2 [Solanum lycopersicum] Length = 514 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +3 Query: 423 RSILRALSGPD--PPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 R ILRA+SG D PD A ELN+T+FD VLK +PA +AIVEFFAH Sbjct: 31 RVILRAISGQDGEKPDFAVELNATNFDSVLKETPAPYAIVEFFAH 75 >ref|XP_004236966.1| PREDICTED: sulfhydryl oxidase 2-like isoform 1 [Solanum lycopersicum] Length = 518 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 2/45 (4%) Frame = +3 Query: 423 RSILRALSGPD--PPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 R ILRA+SG D PD A ELN+T+FD VLK +PA +AIVEFFAH Sbjct: 31 RVILRAISGQDGEKPDFAVELNATNFDSVLKETPAPYAIVEFFAH 75 >ref|XP_006398514.1| hypothetical protein EUTSA_v10000862mg [Eutrema salsugineum] gi|567168899|ref|XP_006398515.1| hypothetical protein EUTSA_v10000862mg [Eutrema salsugineum] gi|557099603|gb|ESQ39967.1| hypothetical protein EUTSA_v10000862mg [Eutrema salsugineum] gi|557099604|gb|ESQ39968.1| hypothetical protein EUTSA_v10000862mg [Eutrema salsugineum] Length = 503 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/52 (59%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = +3 Query: 402 SSAPVGSRSILRALSG--PDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 SS+P GSRSILR + G D D A ELN+T+FD VL+ +PA +A+VEFFAH Sbjct: 20 SSSP-GSRSILRDIGGGNADQKDKAVELNTTNFDSVLRDTPAKYAVVEFFAH 70 >ref|XP_006290965.1| hypothetical protein CARUB_v10017079mg [Capsella rubella] gi|482559672|gb|EOA23863.1| hypothetical protein CARUB_v10017079mg [Capsella rubella] Length = 496 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 A+SA GSR ILR ++ D D A ELN+T+FD VLK +PA +A+VEFFAH Sbjct: 15 AASASPGSRLILREIA--DQKDKAVELNTTNFDSVLKDTPAKYAVVEFFAH 63 >ref|XP_002875066.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis lyrata subsp. lyrata] gi|297320904|gb|EFH51325.1| quiescin-sulfhydryl oxidase 2 [Arabidopsis lyrata subsp. lyrata] Length = 495 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDPPDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 ASS+ GSR ILR ++ D D A ELN+T+FD VLK +PA +A+VEFFAH Sbjct: 16 ASSSSPGSRLILREIA--DQKDKAVELNTTNFDSVLKDTPAKYAVVEFFAH 64 >ref|XP_002536486.1| protein disulfide-isomerase, putative [Ricinus communis] gi|223519539|gb|EEF25897.1| protein disulfide-isomerase, putative [Ricinus communis] Length = 172 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDP--PDAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 A+S P GSRS+LR +S PD A +LN ++FD VL+ +PA+FA+VEFFAH Sbjct: 20 AASFPSGSRSVLREISKDSTVKPDYAVDLNISNFDAVLRDTPATFAVVEFFAH 72 >ref|XP_002311489.1| thioredoxin family protein [Populus trichocarpa] gi|222851309|gb|EEE88856.1| thioredoxin family protein [Populus trichocarpa] Length = 513 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = +3 Query: 399 ASSAPVGSRSILRALSGPDPP--DAAFELNSTDFDLVLKRSPASFAIVEFFAH 551 A+S GSRSILRA+S + D A +LNST+FD VL+ +PA+ AIVEFFAH Sbjct: 23 AASIQSGSRSILRAVSSENKAQVDYAVDLNSTNFDAVLRNTPAAHAIVEFFAH 75