BLASTX nr result
ID: Sinomenium21_contig00026830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026830 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199817.1| hypothetical protein PRUPE_ppa005214mg [Prun... 57 2e-06 >ref|XP_007199817.1| hypothetical protein PRUPE_ppa005214mg [Prunus persica] gi|462395217|gb|EMJ01016.1| hypothetical protein PRUPE_ppa005214mg [Prunus persica] Length = 472 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/41 (51%), Positives = 32/41 (78%) Frame = -3 Query: 365 GLVMEPCLNYSKKRKWFRFSTSSDLPDLDVPNPECYEPLIN 243 GLV++PC+ Y+K+ +WF FS +SDLPD+ P+ +C EP I+ Sbjct: 432 GLVLQPCVEYTKRNRWFNFSMNSDLPDIHAPDHQCNEPWIS 472