BLASTX nr result
ID: Sinomenium21_contig00026823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026823 (1586 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841904.1| hypothetical protein AMTR_s00042p00120080 [A... 65 1e-07 gb|ABR16864.1| unknown [Picea sitchensis] 62 6e-07 ref|XP_006440887.1| hypothetical protein CICLE_v10022641mg [Citr... 61 2e-06 ref|XP_002511998.1| TATA-binding protein-associated phosphoprote... 61 2e-06 ref|XP_004508593.1| PREDICTED: protein Dr1 homolog isoform X2 [C... 60 4e-06 ref|XP_002272187.1| PREDICTED: protein Dr1 homolog [Vitis vinife... 60 4e-06 gb|AFK36589.1| unknown [Lotus japonicus] 59 8e-06 >ref|XP_006841904.1| hypothetical protein AMTR_s00042p00120080 [Amborella trichopoda] gi|548843930|gb|ERN03579.1| hypothetical protein AMTR_s00042p00120080 [Amborella trichopoda] Length = 155 Score = 64.7 bits (156), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 +VLGFGDYI+EV+AAYEQHKLETLDSP+ GKW Sbjct: 80 EVLGFGDYIEEVYAAYEQHKLETLDSPKAGKW 111 >gb|ABR16864.1| unknown [Picea sitchensis] Length = 151 Score = 62.4 bits (150), Expect = 6e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 +VLGFGDYI+EV+AAYEQH+LETLDSP+ G+W Sbjct: 80 EVLGFGDYIEEVYAAYEQHRLETLDSPKSGRW 111 >ref|XP_006440887.1| hypothetical protein CICLE_v10022641mg [Citrus clementina] gi|568882943|ref|XP_006494261.1| PREDICTED: protein Dr1 homolog isoform X2 [Citrus sinensis] gi|557543149|gb|ESR54127.1| hypothetical protein CICLE_v10022641mg [Citrus clementina] Length = 156 Score = 60.8 bits (146), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 +VLGFG+YI+EV+AAYEQHKLET+DS +GGKW Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMDSLKGGKW 111 >ref|XP_002511998.1| TATA-binding protein-associated phosphoprotein, putative [Ricinus communis] gi|223549178|gb|EEF50667.1| TATA-binding protein-associated phosphoprotein, putative [Ricinus communis] Length = 155 Score = 60.8 bits (146), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 +VLGFG+YI+EV+AAYEQHKLET+DS +GGKW Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMDSLKGGKW 111 >ref|XP_004508593.1| PREDICTED: protein Dr1 homolog isoform X2 [Cicer arietinum] Length = 219 Score = 59.7 bits (143), Expect = 4e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 QVLGF +YI+EV+AAYEQHKLET+DS +GGKW Sbjct: 144 QVLGFSEYIEEVYAAYEQHKLETMDSLKGGKW 175 >ref|XP_002272187.1| PREDICTED: protein Dr1 homolog [Vitis vinifera] gi|297734148|emb|CBI15395.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 59.7 bits (143), Expect = 4e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETLDSPRGGKW 1586 +VLGFG+YI+EV+AAYEQHKLET+D+ +GGKW Sbjct: 80 EVLGFGEYIEEVYAAYEQHKLETMDTIKGGKW 111 >gb|AFK36589.1| unknown [Lotus japonicus] Length = 156 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/33 (78%), Positives = 31/33 (93%), Gaps = 1/33 (3%) Frame = +3 Query: 1491 QVLGFGDYIDEVFAAYEQHKLETL-DSPRGGKW 1586 +VLGFGDYI+EV+AAYEQHKLET+ DS +GGKW Sbjct: 80 EVLGFGDYIEEVYAAYEQHKLETMQDSSKGGKW 112