BLASTX nr result
ID: Sinomenium21_contig00026745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026745 (859 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163270.1| hypothetical protein PHAVU_001G220300g [Phas... 59 3e-06 >ref|XP_007163270.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris] gi|561036734|gb|ESW35264.1| hypothetical protein PHAVU_001G220300g [Phaseolus vulgaris] Length = 1342 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 859 PIEILPPGMVSLAAPIIIQKKPTSATPGSQQPPSK 755 PIEILPPGM+SL API IQKKP SAT SQQPP K Sbjct: 1180 PIEILPPGMMSLNAPISIQKKPASATQNSQQPPEK 1214