BLASTX nr result
ID: Sinomenium21_contig00026712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026712 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051687.1| GRIP-related ARF-binding domain-containing p... 56 5e-06 >ref|XP_007051687.1| GRIP-related ARF-binding domain-containing protein 1 isoform 1 [Theobroma cacao] gi|508703948|gb|EOX95844.1| GRIP-related ARF-binding domain-containing protein 1 isoform 1 [Theobroma cacao] Length = 767 Score = 56.2 bits (134), Expect = 5e-06 Identities = 34/78 (43%), Positives = 43/78 (55%), Gaps = 9/78 (11%) Frame = +1 Query: 31 SVEGNRKTEGDKHQRSPSSTGAAASVPDHRTT---------NISRLVGVGPSASQRNLMQ 183 S E +++ + H RSP +TG + SVP+ RTT + S GP Q N Q Sbjct: 679 SAEDASRSKENLHGRSPDATGTSPSVPNQRTTTAGSGFSRSSFSPSQNSGPVPPQGNFRQ 738 Query: 184 PEHLDTEFSTVPLTSSVS 237 EH D+EFSTVPLTSS S Sbjct: 739 FEHSDSEFSTVPLTSSES 756