BLASTX nr result
ID: Sinomenium21_contig00026550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026550 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842123.1| hypothetical protein AMTR_s00078p00107740 [A... 60 4e-07 >ref|XP_006842123.1| hypothetical protein AMTR_s00078p00107740 [Amborella trichopoda] gi|548844172|gb|ERN03798.1| hypothetical protein AMTR_s00078p00107740 [Amborella trichopoda] Length = 645 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 2 MARADQKRYKEAMAGYKSAPAIVDSGNESDSE 97 MARAD KRYKEAMAGYKSAP +DSGNESDSE Sbjct: 614 MARADSKRYKEAMAGYKSAPTNIDSGNESDSE 645