BLASTX nr result
ID: Sinomenium21_contig00026350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026350 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556374.1| PREDICTED: phosphatidate cytidylyltransferas... 58 2e-06 ref|XP_003536226.1| PREDICTED: phosphatidate cytidylyltransferas... 58 2e-06 >ref|XP_003556374.1| PREDICTED: phosphatidate cytidylyltransferase-like [Glycine max] Length = 424 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 181 MQKDNNGTAPSTTSGRIRHRKRSNDVPAEFSKANGS 288 MQKD + TAPSTTSGR+RHRKRSN+V E SKANG+ Sbjct: 1 MQKDTSTTAPSTTSGRVRHRKRSNEVIPEVSKANGT 36 >ref|XP_003536226.1| PREDICTED: phosphatidate cytidylyltransferase-like [Glycine max] Length = 424 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 181 MQKDNNGTAPSTTSGRIRHRKRSNDVPAEFSKANGS 288 MQKD + TAPSTTSGR+RHRKRSN+V E SKANG+ Sbjct: 1 MQKDTSTTAPSTTSGRVRHRKRSNEVIPEVSKANGT 36