BLASTX nr result
ID: Sinomenium21_contig00026326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026326 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485057.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 62 8e-08 ref|XP_006485056.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 62 8e-08 ref|XP_006437002.1| hypothetical protein CICLE_v10030921mg [Citr... 62 8e-08 ref|XP_006437001.1| hypothetical protein CICLE_v10030921mg [Citr... 62 8e-08 ref|XP_006437000.1| hypothetical protein CICLE_v10030921mg [Citr... 62 8e-08 ref|XP_006436999.1| hypothetical protein CICLE_v10030921mg [Citr... 62 8e-08 ref|XP_007038189.1| Amidase family protein isoform 2 [Theobroma ... 61 1e-07 ref|XP_007038188.1| Glutamyl-tRNA(Gln) amidotransferase subunit ... 61 1e-07 ref|XP_002511063.1| Glutamyl-tRNA(Gln) amidotransferase subunit ... 60 4e-07 ref|XP_006366281.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 57 3e-06 ref|NP_196353.2| amidase family protein [Arabidopsis thaliana] g... 57 3e-06 dbj|BAC53930.1| amidase-like protein [Nicotiana tabacum] 57 3e-06 emb|CAB87925.1| putative amidase [Arabidopsis thaliana] 57 3e-06 ref|XP_002873306.1| amidase family protein [Arabidopsis lyrata s... 57 3e-06 ref|NP_001078540.1| amidase family protein [Arabidopsis thaliana... 57 3e-06 dbj|BAF00386.1| putative amidase [Arabidopsis thaliana] 57 3e-06 ref|XP_004241644.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 56 5e-06 ref|XP_004309489.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 56 6e-06 >ref|XP_006485057.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like isoform X2 [Citrus sinensis] Length = 552 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 515 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 551 >ref|XP_006485056.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like isoform X1 [Citrus sinensis] Length = 652 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 615 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 651 >ref|XP_006437002.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] gi|557539198|gb|ESR50242.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] Length = 464 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 427 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 463 >ref|XP_006437001.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] gi|557539197|gb|ESR50241.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] Length = 652 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 615 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 651 >ref|XP_006437000.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] gi|557539196|gb|ESR50240.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] Length = 552 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 515 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 551 >ref|XP_006436999.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] gi|557539195|gb|ESR50239.1| hypothetical protein CICLE_v10030921mg [Citrus clementina] Length = 618 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND+IPNPP V P R H Sbjct: 581 YQSVTDHHKQRPPIDNLGPNDIIPNPPTVTIPPRILH 617 >ref|XP_007038189.1| Amidase family protein isoform 2 [Theobroma cacao] gi|508775434|gb|EOY22690.1| Amidase family protein isoform 2 [Theobroma cacao] Length = 601 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRR 135 YQSVT HHKQ PPI DLGPND IPNPP V P RR Sbjct: 567 YQSVTSHHKQRPPIDDLGPNDTIPNPPTVTIPPRR 601 >ref|XP_007038188.1| Glutamyl-tRNA(Gln) amidotransferase subunit A isoform 1 [Theobroma cacao] gi|590670913|ref|XP_007038190.1| Glutamyl-tRNA(Gln) amidotransferase subunit A isoform 1 [Theobroma cacao] gi|508775433|gb|EOY22689.1| Glutamyl-tRNA(Gln) amidotransferase subunit A isoform 1 [Theobroma cacao] gi|508775435|gb|EOY22691.1| Glutamyl-tRNA(Gln) amidotransferase subunit A isoform 1 [Theobroma cacao] Length = 641 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRR 135 YQSVT HHKQ PPI DLGPND IPNPP V P RR Sbjct: 607 YQSVTSHHKQRPPIDDLGPNDTIPNPPTVTIPPRR 641 >ref|XP_002511063.1| Glutamyl-tRNA(Gln) amidotransferase subunit A, putative [Ricinus communis] gi|223550178|gb|EEF51665.1| Glutamyl-tRNA(Gln) amidotransferase subunit A, putative [Ricinus communis] Length = 581 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTDHHKQ PPI +LGPND IP+PP V P RR H Sbjct: 544 YQSVTDHHKQRPPIDNLGPNDKIPDPPIVVIPPRRLH 580 >ref|XP_006366281.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like [Solanum tuberosum] Length = 542 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRR 135 YQSVT+HHKQ PPI D+GPND IPNPP P R+ Sbjct: 504 YQSVTNHHKQRPPIDDIGPNDSIPNPPTSAVPARQ 538 >ref|NP_196353.2| amidase family protein [Arabidopsis thaliana] gi|332003759|gb|AED91142.1| amidase family protein [Arabidopsis thaliana] Length = 659 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTD H++ PPI DLGP+D IPNPPR P RR H Sbjct: 622 YQSVTDAHRKRPPIDDLGPDDSIPNPPRALIPPRRLH 658 >dbj|BAC53930.1| amidase-like protein [Nicotiana tabacum] Length = 542 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRR 135 YQSVT+HHKQ PPI D+GPND IPNPP P R+ Sbjct: 504 YQSVTNHHKQRPPIDDIGPNDSIPNPPTSMIPARQ 538 >emb|CAB87925.1| putative amidase [Arabidopsis thaliana] Length = 657 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTD H++ PPI DLGP+D IPNPPR P RR H Sbjct: 620 YQSVTDAHRKRPPIDDLGPDDSIPNPPRALIPPRRLH 656 >ref|XP_002873306.1| amidase family protein [Arabidopsis lyrata subsp. lyrata] gi|297319143|gb|EFH49565.1| amidase family protein [Arabidopsis lyrata subsp. lyrata] Length = 622 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTD H++ PPI DLGP+D IPNPPR P RR H Sbjct: 585 YQSVTDAHRKRPPIDDLGPDDSIPNPPRALIPPRRLH 621 >ref|NP_001078540.1| amidase family protein [Arabidopsis thaliana] gi|332003760|gb|AED91143.1| amidase family protein [Arabidopsis thaliana] Length = 652 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTD H++ PPI DLGP+D IPNPPR P RR H Sbjct: 615 YQSVTDAHRKRPPIDDLGPDDSIPNPPRALIPPRRLH 651 >dbj|BAF00386.1| putative amidase [Arabidopsis thaliana] Length = 652 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRRWH 141 YQSVTD H++ PPI DLGP+D IPNPPR P RR H Sbjct: 615 YQSVTDAHRKRPPIDDLGPDDSIPNPPRALIPPRRLH 651 >ref|XP_004241644.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Solanum lycopersicum] Length = 595 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRVNYPLRR 135 YQS+T+HHKQ PPI D+GPND IPNPP P R+ Sbjct: 557 YQSLTNHHKQRPPIDDIGPNDSIPNPPTSTVPARQ 591 >ref|XP_004309489.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Fragaria vesca subsp. vesca] Length = 585 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 31 YQSVTDHHKQGPPIHDLGPNDLIPNPPRV 117 +QSVTDHHKQ PPI DLGP+D+IPNPP V Sbjct: 549 FQSVTDHHKQRPPIDDLGPDDVIPNPPSV 577