BLASTX nr result
ID: Sinomenium21_contig00026320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026320 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264641.1| PREDICTED: RNA pseudourine synthase 6, chlor... 55 8e-06 emb|CAN68642.1| hypothetical protein VITISV_030809 [Vitis vinifera] 55 8e-06 >ref|XP_002264641.1| PREDICTED: RNA pseudourine synthase 6, chloroplastic [Vitis vinifera] gi|302144082|emb|CBI23187.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = +2 Query: 83 GAASFSAILAGGLVSSLWAPSCRNFSAPIALVRTLASALVVKKRDKNLGLCSS 241 G A ++I GLVSSLW +CR+F P+AL RTLAS+ V +R K + CS+ Sbjct: 2 GTAILTSIFTSGLVSSLWNSNCRSFGTPVALARTLASSNVFSRRHKRVVWCSN 54 >emb|CAN68642.1| hypothetical protein VITISV_030809 [Vitis vinifera] Length = 400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/53 (49%), Positives = 35/53 (66%) Frame = +2 Query: 83 GAASFSAILAGGLVSSLWAPSCRNFSAPIALVRTLASALVVKKRDKNLGLCSS 241 G A ++I GLVSSLW +CR+F P+AL RTLAS+ V +R K + CS+ Sbjct: 2 GTAILTSIFTSGLVSSLWNSNCRSFGTPVALARTLASSNVFSRRHKRVVWCSN 54