BLASTX nr result
ID: Sinomenium21_contig00026238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026238 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305703.1| hypothetical protein POPTR_0004s06390g [Popu... 62 1e-07 ref|XP_006410602.1| hypothetical protein EUTSA_v10016803mg [Eutr... 60 2e-07 ref|XP_006294387.1| hypothetical protein CARUB_v10023403mg [Caps... 60 2e-07 ref|XP_004293524.1| PREDICTED: katanin p60 ATPase-containing sub... 60 2e-07 ref|NP_973600.1| nucleoside triphosphatase CCP1 [Arabidopsis tha... 60 2e-07 ref|XP_002879503.1| hypothetical protein ARALYDRAFT_482419 [Arab... 60 2e-07 ref|NP_565791.1| nucleoside triphosphatase CCP1 [Arabidopsis tha... 60 2e-07 gb|EYU43262.1| hypothetical protein MIMGU_mgv1a007467mg [Mimulus... 60 4e-07 gb|EXC29352.1| Katanin p60 ATPase-containing subunit A-like 2 [M... 60 4e-07 ref|XP_006352974.1| PREDICTED: katanin p60 ATPase-containing sub... 60 4e-07 ref|XP_006352973.1| PREDICTED: katanin p60 ATPase-containing sub... 60 4e-07 ref|XP_007158924.1| hypothetical protein PHAVU_002G193200g [Phas... 60 4e-07 ref|XP_004504678.1| PREDICTED: katanin p60 ATPase-containing sub... 60 4e-07 ref|XP_007211692.1| hypothetical protein PRUPE_ppa009191mg [Prun... 60 4e-07 ref|XP_004233128.1| PREDICTED: katanin p60 ATPase-containing sub... 60 4e-07 ref|XP_004233127.1| PREDICTED: katanin p60 ATPase-containing sub... 60 4e-07 gb|AFK39782.1| unknown [Lotus japonicus] 60 4e-07 ref|XP_003608508.1| Katanin p60 ATPase-containing subunit A-like... 60 4e-07 ref|XP_006646337.1| PREDICTED: katanin p60 ATPase-containing sub... 59 5e-07 ref|XP_006377613.1| hypothetical protein POPTR_0011s08360g [Popu... 59 5e-07 >ref|XP_002305703.1| hypothetical protein POPTR_0004s06390g [Populus trichocarpa] gi|222848667|gb|EEE86214.1| hypothetical protein POPTR_0004s06390g [Populus trichocarpa] Length = 384 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RTNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 238 RTNELVFVLAATNLPWELDAAMLRRLEKRI 267 >ref|XP_006410602.1| hypothetical protein EUTSA_v10016803mg [Eutrema salsugineum] gi|557111771|gb|ESQ52055.1| hypothetical protein EUTSA_v10016803mg [Eutrema salsugineum] Length = 379 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 233 KTNELVFVLAATNLPWELDAAMLRRLEKRI 262 >ref|XP_006294387.1| hypothetical protein CARUB_v10023403mg [Capsella rubella] gi|482563095|gb|EOA27285.1| hypothetical protein CARUB_v10023403mg [Capsella rubella] Length = 387 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 241 KTNELVFVLAATNLPWELDAAMLRRLEKRI 270 >ref|XP_004293524.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like [Fragaria vesca subsp. vesca] Length = 404 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 258 KTNELVFVLAATNLPWELDAAMLRRLEKRI 287 >ref|NP_973600.1| nucleoside triphosphatase CCP1 [Arabidopsis thaliana] gi|222423637|dbj|BAH19787.1| AT2G34560 [Arabidopsis thaliana] gi|222423678|dbj|BAH19806.1| AT2G34560 [Arabidopsis thaliana] gi|330253897|gb|AEC08991.1| nucleoside triphosphatase CCP1 [Arabidopsis thaliana] Length = 393 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 247 KTNELVFVLAATNLPWELDAAMLRRLEKRI 276 >ref|XP_002879503.1| hypothetical protein ARALYDRAFT_482419 [Arabidopsis lyrata subsp. lyrata] gi|297325342|gb|EFH55762.1| hypothetical protein ARALYDRAFT_482419 [Arabidopsis lyrata subsp. lyrata] Length = 390 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 244 KTNELVFVLAATNLPWELDAAMLRRLEKRI 273 >ref|NP_565791.1| nucleoside triphosphatase CCP1 [Arabidopsis thaliana] gi|20197082|gb|AAC26698.2| putative katanin [Arabidopsis thaliana] gi|21537081|gb|AAM61422.1| putative katanin [Arabidopsis thaliana] gi|114050617|gb|ABI49458.1| At2g34560 [Arabidopsis thaliana] gi|222423278|dbj|BAH19615.1| AT2G34560 [Arabidopsis thaliana] gi|330253896|gb|AEC08990.1| nucleoside triphosphatase CCP1 [Arabidopsis thaliana] Length = 384 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TNELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 238 KTNELVFVLAATNLPWELDAAMLRRLEKRI 267 >gb|EYU43262.1| hypothetical protein MIMGU_mgv1a007467mg [Mimulus guttatus] Length = 406 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 261 RTDELVFVLAATNLPWELDAAMLRRLEKRI 290 >gb|EXC29352.1| Katanin p60 ATPase-containing subunit A-like 2 [Morus notabilis] Length = 405 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 259 RTDELVFVLAATNLPWELDAAMLRRLEKRI 288 >ref|XP_006352974.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like isoform X2 [Solanum tuberosum] Length = 386 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 240 RTDELVFVLAATNLPWELDAAMLRRLEKRI 269 >ref|XP_006352973.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like isoform X1 [Solanum tuberosum] Length = 388 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 242 RTDELVFVLAATNLPWELDAAMLRRLEKRI 271 >ref|XP_007158924.1| hypothetical protein PHAVU_002G193200g [Phaseolus vulgaris] gi|561032339|gb|ESW30918.1| hypothetical protein PHAVU_002G193200g [Phaseolus vulgaris] Length = 412 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 265 RTDELVFVLAATNLPWELDAAMLRRLEKRI 294 >ref|XP_004504678.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like [Cicer arietinum] Length = 406 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 260 RTDELVFVLAATNLPWELDAAMLRRLEKRI 289 >ref|XP_007211692.1| hypothetical protein PRUPE_ppa009191mg [Prunus persica] gi|462407557|gb|EMJ12891.1| hypothetical protein PRUPE_ppa009191mg [Prunus persica] Length = 302 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 156 RTSELVFVLAATNLPWELDAAMLRRLEKRI 185 >ref|XP_004233128.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like isoform 2 [Solanum lycopersicum] Length = 386 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 240 RTDELVFVLAATNLPWELDAAMLRRLEKRI 269 >ref|XP_004233127.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like isoform 1 [Solanum lycopersicum] Length = 392 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 240 RTDELVFVLAATNLPWELDAAMLRRLEKRI 269 >gb|AFK39782.1| unknown [Lotus japonicus] Length = 404 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 258 RTDELVFVLAATNLPWELDAAMLRRLEKRI 287 >ref|XP_003608508.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] gi|355509563|gb|AES90705.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago truncatula] Length = 402 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT+ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 256 RTDELVFVLAATNLPWELDAAMLRRLEKRI 285 >ref|XP_006646337.1| PREDICTED: katanin p60 ATPase-containing subunit A-like 2-like [Oryza brachyantha] Length = 525 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 +TN+LVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 375 KTNDLVFVLAATNLPWELDAAMLRRLEKRI 404 >ref|XP_006377613.1| hypothetical protein POPTR_0011s08360g [Populus trichocarpa] gi|550327950|gb|ERP55410.1| hypothetical protein POPTR_0011s08360g [Populus trichocarpa] Length = 405 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 RTNELVFVLAATNLPWELDAAMLRRLEKRV 91 RT ELVFVLAATNLPWELDAAMLRRLEKR+ Sbjct: 259 RTKELVFVLAATNLPWELDAAMLRRLEKRI 288