BLASTX nr result
ID: Sinomenium21_contig00026202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026202 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 59 3e-17 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 92 6e-17 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 76 4e-12 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 59.3 bits (142), Expect(3) = 3e-17 Identities = 31/50 (62%), Positives = 33/50 (66%) Frame = +2 Query: 2 KSNVHRPGE*GCSSVDRSSGLIGGGITPFSKEPYVTLSRHTAPSRNQDPP 151 +SNVH PG GGITPFSKEPYVTLSRHTAPSRN+D P Sbjct: 13 ESNVHGPG---------------GGITPFSKEPYVTLSRHTAPSRNKDLP 47 Score = 50.8 bits (120), Expect(3) = 3e-17 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 196 PFHSFID*FKVALACFQVQALAVEASRQKRTSGPGR 303 PF+S VA+ACFQVQALAVEASRQK TSGPGR Sbjct: 61 PFYS-----SVAVACFQVQALAVEASRQKLTSGPGR 91 Score = 23.5 bits (49), Expect(3) = 3e-17 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 150 PFPLTNGSS 176 PFPLTNGSS Sbjct: 47 PFPLTNGSS 55 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 34 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSVPESGPPPF 156 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGS PESGPPPF Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPF 41 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 117 RESVTYGSFEKGVIPPPIRPDERSTELHPYSPGLCTLL 4 RE++TYGSFEKGV PPPIRPDERSTELHPYSPG CTLL Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSPGPCTLL 917