BLASTX nr result
ID: Sinomenium21_contig00026103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026103 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524951.1| Protein FRIGIDA, putative [Ricinus communis]... 59 9e-07 >ref|XP_002524951.1| Protein FRIGIDA, putative [Ricinus communis] gi|223535786|gb|EEF37448.1| Protein FRIGIDA, putative [Ricinus communis] Length = 570 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -1 Query: 472 YMGASERYPHVAATTYNYQSPSQGVYGQQDAAQRSYYYPQDER 344 Y G ERYPHV Y+YQ PSQ YGQ QR YYYP D+R Sbjct: 499 YTGMPERYPHVGPNPYDYQIPSQSAYGQPATDQRMYYYPADDR 541