BLASTX nr result
ID: Sinomenium21_contig00026001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00026001 (998 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224779.1| hypothetical protein PRUPE_ppa023914mg, part... 63 2e-07 ref|XP_006376422.1| hypothetical protein POPTR_0013s12910g [Popu... 62 3e-07 gb|AEC10971.1| hypothetical protein [Camellia sinensis] 62 4e-07 ref|XP_004140596.1| PREDICTED: trigger factor-like [Cucumis sati... 62 5e-07 ref|XP_006442864.1| hypothetical protein CICLE_v10022254mg [Citr... 61 6e-07 ref|XP_007033786.1| Transport, ribosome-binding, bacterial-like ... 61 6e-07 ref|XP_007033785.1| Transport, ribosome-binding, bacterial, puta... 61 6e-07 ref|XP_007033784.1| Transport, ribosome-binding, bacterial, puta... 61 6e-07 ref|XP_004291607.1| PREDICTED: trigger factor-like [Fragaria ves... 61 8e-07 ref|XP_002273660.1| PREDICTED: trigger factor-like [Vitis vinifera] 59 2e-06 ref|XP_002530570.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 emb|CBI24665.3| unnamed protein product [Vitis vinifera] 59 2e-06 ref|NP_001241304.1| uncharacterized protein LOC100798146 [Glycin... 59 3e-06 ref|XP_006830351.1| hypothetical protein AMTR_s00116p00071770 [A... 58 7e-06 >ref|XP_007224779.1| hypothetical protein PRUPE_ppa023914mg, partial [Prunus persica] gi|462421715|gb|EMJ25978.1| hypothetical protein PRUPE_ppa023914mg, partial [Prunus persica] Length = 157 Score = 63.2 bits (152), Expect = 2e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSGAK++AIFDE+F KMV AQPIPGFRRVKGG Sbjct: 46 INVEVSGAKTRAIFDEVFDKMVTAAQPIPGFRRVKGG 82 >ref|XP_006376422.1| hypothetical protein POPTR_0013s12910g [Populus trichocarpa] gi|550325698|gb|ERP54219.1| hypothetical protein POPTR_0013s12910g [Populus trichocarpa] Length = 210 Score = 62.4 bits (150), Expect = 3e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 IRV+VSGAK++AIF+++F KMV AQPIPGFRRVKGG Sbjct: 96 IRVEVSGAKTRAIFEDVFKKMVTAAQPIPGFRRVKGG 132 >gb|AEC10971.1| hypothetical protein [Camellia sinensis] Length = 209 Score = 62.0 bits (149), Expect = 4e-07 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSG K+Q+IFD++FSKMV +AQPIPGFRR+KGG Sbjct: 95 ISVEVSGTKTQSIFDDVFSKMVADAQPIPGFRRLKGG 131 >ref|XP_004140596.1| PREDICTED: trigger factor-like [Cucumis sativus] gi|449487315|ref|XP_004157566.1| PREDICTED: trigger factor-like [Cucumis sativus] Length = 208 Score = 61.6 bits (148), Expect = 5e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 IRV+VSGAK++AIF+ +F +MV EAQPIPGFRRVKGG Sbjct: 94 IRVEVSGAKTRAIFNVVFDRMVAEAQPIPGFRRVKGG 130 >ref|XP_006442864.1| hypothetical protein CICLE_v10022254mg [Citrus clementina] gi|568850149|ref|XP_006478789.1| PREDICTED: uncharacterized protein LOC102622273 [Citrus sinensis] gi|557545126|gb|ESR56104.1| hypothetical protein CICLE_v10022254mg [Citrus clementina] Length = 209 Score = 61.2 bits (147), Expect = 6e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSGAK++AIFD++F KMV AQPIPGFRRVKGG Sbjct: 95 IGVEVSGAKTRAIFDDVFDKMVAAAQPIPGFRRVKGG 131 >ref|XP_007033786.1| Transport, ribosome-binding, bacterial-like protein isoform 3 [Theobroma cacao] gi|508712815|gb|EOY04712.1| Transport, ribosome-binding, bacterial-like protein isoform 3 [Theobroma cacao] Length = 174 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V++SGAK++AIFD++F KMV AQPIPGFRRVKGG Sbjct: 94 ISVEISGAKTRAIFDDVFDKMVAAAQPIPGFRRVKGG 130 >ref|XP_007033785.1| Transport, ribosome-binding, bacterial, putative isoform 2 [Theobroma cacao] gi|508712814|gb|EOY04711.1| Transport, ribosome-binding, bacterial, putative isoform 2 [Theobroma cacao] Length = 208 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V++SGAK++AIFD++F KMV AQPIPGFRRVKGG Sbjct: 94 ISVEISGAKTRAIFDDVFDKMVAAAQPIPGFRRVKGG 130 >ref|XP_007033784.1| Transport, ribosome-binding, bacterial, putative isoform 1 [Theobroma cacao] gi|508712813|gb|EOY04710.1| Transport, ribosome-binding, bacterial, putative isoform 1 [Theobroma cacao] Length = 230 Score = 61.2 bits (147), Expect = 6e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V++SGAK++AIFD++F KMV AQPIPGFRRVKGG Sbjct: 94 ISVEISGAKTRAIFDDVFDKMVAAAQPIPGFRRVKGG 130 >ref|XP_004291607.1| PREDICTED: trigger factor-like [Fragaria vesca subsp. vesca] Length = 211 Score = 60.8 bits (146), Expect = 8e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSG K+QAIFD +F KMV AQPIPGFRRVKGG Sbjct: 99 ISVEVSGTKTQAIFDHVFDKMVAAAQPIPGFRRVKGG 135 >ref|XP_002273660.1| PREDICTED: trigger factor-like [Vitis vinifera] Length = 212 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V++SG K++ IFD +FSKMV +AQPIPGFRRVKGG Sbjct: 98 ISVELSGVKTRTIFDNVFSKMVADAQPIPGFRRVKGG 134 >ref|XP_002530570.1| conserved hypothetical protein [Ricinus communis] gi|223529869|gb|EEF31800.1| conserved hypothetical protein [Ricinus communis] Length = 187 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSG K++AIFD +F KMV AQPIPGFRRVKGG Sbjct: 73 ISVEVSGVKTRAIFDNVFEKMVAAAQPIPGFRRVKGG 109 >emb|CBI24665.3| unnamed protein product [Vitis vinifera] Length = 206 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V++SG K++ IFD +FSKMV +AQPIPGFRRVKGG Sbjct: 92 ISVELSGVKTRTIFDNVFSKMVADAQPIPGFRRVKGG 128 >ref|NP_001241304.1| uncharacterized protein LOC100798146 [Glycine max] gi|571448396|ref|XP_006577822.1| PREDICTED: uncharacterized protein LOC100798146 isoform X1 [Glycine max] gi|255646296|gb|ACU23632.1| unknown [Glycine max] Length = 204 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKGG 886 I V+VSG K+Q IFD++F KMV AQPIPGFRRVKGG Sbjct: 92 ISVEVSGNKTQRIFDDVFKKMVAAAQPIPGFRRVKGG 128 >ref|XP_006830351.1| hypothetical protein AMTR_s00116p00071770 [Amborella trichopoda] gi|548836621|gb|ERM97767.1| hypothetical protein AMTR_s00116p00071770 [Amborella trichopoda] Length = 223 Score = 57.8 bits (138), Expect = 7e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 996 IRVDVSGAKSQAIFDEIFSKMVVEAQPIPGFRRVKG 889 ++V VSGAK+Q IFDE+FSK+V AQPIPGFRRVKG Sbjct: 92 MKVVVSGAKTQKIFDEVFSKLVEAAQPIPGFRRVKG 127