BLASTX nr result
ID: Sinomenium21_contig00025906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00025906 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYE99138.1| histone H4, partial [Aspergillus ruber CBS 135680] 113 3e-23 gb|EWY86807.1| histone H4 [Fusarium oxysporum FOSC 3-a] gi|58768... 113 3e-23 ref|XP_001727505.1| histone H4 [Aspergillus oryzae RIB40] gi|212... 113 3e-23 ref|XP_384465.1| hypothetical protein FG04289.1 [Fusarium gramin... 113 3e-23 gb|EPS40300.1| hypothetical protein H072_5895 [Dactylellina hapt... 113 3e-23 gb|EGU80380.1| hypothetical protein FOXB_09128 [Fusarium oxyspor... 113 3e-23 ref|XP_003048470.1| histone H4 [Nectria haematococca mpVI 77-13-... 113 3e-23 ref|XP_002561525.1| Pc16g12260 [Penicillium chrysogenum Wisconsi... 113 3e-23 ref|XP_658338.1| H4_NEUCR Histone H4 [Aspergillus nidulans FGSC ... 113 3e-23 ref|XP_385667.1| H4_NEUCR Histone H4 [Fusarium graminearum PH-1]... 113 3e-23 gb|ETS00204.1| histone-fold-containing protein [Trichoderma rees... 111 9e-23 gb|AAW69330.1| histone H4-like protein [Magnaporthe grisea] 111 9e-23 ref|XP_003667082.1| H4-like protein, partial [Myceliophthora the... 111 9e-23 ref|XP_003655325.1| histone H4-like protein, partial [Thielavia ... 111 9e-23 ref|XP_001910030.1| hypothetical protein [Podospora anserina S m... 111 9e-23 ref|XP_001548661.1| histone H4 [Botryotinia fuckeliana B05.10] g... 111 9e-23 gb|EUN23284.1| hypothetical protein COCVIDRAFT_29861 [Bipolaris ... 110 2e-22 gb|EUC48318.1| hypothetical protein COCMIDRAFT_2761 [Bipolaris o... 110 2e-22 gb|EUC27673.1| hypothetical protein COCCADRAFT_9791 [Bipolaris z... 110 2e-22 gb|ENI00941.1| hypothetical protein COCC4DRAFT_149394, partial [... 110 2e-22 >gb|EYE99138.1| histone H4, partial [Aspergillus ruber CBS 135680] Length = 87 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 32 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 87 >gb|EWY86807.1| histone H4 [Fusarium oxysporum FOSC 3-a] gi|587688277|gb|EWZ34882.1| histone H4 [Fusarium oxysporum Fo47] gi|587723685|gb|EWZ95022.1| histone H4 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587741127|gb|EXA38843.1| histone H4 [Fusarium oxysporum f. sp. pisi HDV247] gi|590067477|gb|EXK95001.1| histone H4 [Fusarium oxysporum f. sp. raphani 54005] gi|591413462|gb|EXL48599.1| histone H4 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591473962|gb|EXM05174.1| histone H4 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591501689|gb|EXM31073.1| histone H4 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 102 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 47 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 102 >ref|XP_001727505.1| histone H4 [Aspergillus oryzae RIB40] gi|212531987|ref|XP_002146150.1| histone H4.1 [Talaromyces marneffei ATCC 18224] gi|238489089|ref|XP_002375782.1| histone H4.1 [Aspergillus flavus NRRL3357] gi|122092|sp|P23750.2|H41_EMENI RecName: Full=Histone H4.1 gi|51315720|sp|Q76MU7.3|H4_ASPOR RecName: Full=Histone H4 gi|296341|emb|CAA39155.1| H4.1 [Aspergillus nidulans] gi|529955|gb|AAA20820.1| histone H4.1 [Aspergillus nidulans] gi|9955877|dbj|BAB12238.1| histone H4 [Aspergillus oryzae] gi|83770533|dbj|BAE60666.1| unnamed protein product [Aspergillus oryzae RIB40] gi|210071514|gb|EEA25603.1| histone H4.1 [Talaromyces marneffei ATCC 18224] gi|220698170|gb|EED54510.1| histone H4.1 [Aspergillus flavus NRRL3357] gi|259488986|tpe|CBF88885.1| TPA: Histone H4.1 [Source:UniProtKB/Swiss-Prot;Acc:P23750] [Aspergillus nidulans FGSC A4] gi|425770105|gb|EKV08579.1| Histone H4.1 [Penicillium digitatum Pd1] gi|425771652|gb|EKV10089.1| Histone H4.1 [Penicillium digitatum PHI26] gi|525579049|gb|EPS25299.1| hypothetical protein PDE_00232 [Penicillium oxalicum 114-2] gi|584410804|emb|CDM34835.1| Histone H4 [Penicillium roqueforti] gi|227597|prf||1707275C histone H4.1 Length = 103 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 48 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103 >ref|XP_384465.1| hypothetical protein FG04289.1 [Fusarium graminearum PH-1] Length = 81 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 26 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 81 >gb|EPS40300.1| hypothetical protein H072_5895 [Dactylellina haptotyla CBS 200.50] Length = 252 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 197 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 252 >gb|EGU80380.1| hypothetical protein FOXB_09128 [Fusarium oxysporum Fo5176] gi|521774784|gb|EPQ65913.1| histone H4 protein, partial [Blumeria graminis f. sp. tritici 96224] Length = 99 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 44 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 99 >ref|XP_003048470.1| histone H4 [Nectria haematococca mpVI 77-13-4] gi|302903065|ref|XP_003048777.1| histone H4 [Nectria haematococca mpVI 77-13-4] gi|256729403|gb|EEU42757.1| histone H4 [Nectria haematococca mpVI 77-13-4] gi|256729711|gb|EEU43064.1| histone H4 [Nectria haematococca mpVI 77-13-4] gi|451992119|gb|EMD84641.1| hypothetical protein COCHEDRAFT_1122542, partial [Bipolaris maydis C5] gi|452004566|gb|EMD97022.1| hypothetical protein COCHEDRAFT_1085088, partial [Bipolaris maydis C5] gi|452981243|gb|EME81003.1| hypothetical protein MYCFIDRAFT_28465, partial [Pseudocercospora fijiensis CIRAD86] gi|477587432|gb|ENI04514.1| hypothetical protein COCC4DRAFT_140591, partial [Bipolaris maydis ATCC 48331] gi|576915041|gb|EUC29361.1| hypothetical protein COCCADRAFT_106720, partial [Bipolaris zeicola 26-R-13] gi|576937949|gb|EUC51435.1| hypothetical protein COCMIDRAFT_79270, partial [Bipolaris oryzae ATCC 44560] gi|578484444|gb|EUN21969.1| hypothetical protein COCVIDRAFT_112648, partial [Bipolaris victoriae FI3] Length = 89 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 34 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 89 >ref|XP_002561525.1| Pc16g12260 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586148|emb|CAP93896.1| Pc16g12260 [Penicillium chrysogenum Wisconsin 54-1255] Length = 134 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 79 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 134 >ref|XP_658338.1| H4_NEUCR Histone H4 [Aspergillus nidulans FGSC A4] gi|40746220|gb|EAA65376.1| H4_NEUCR Histone H4 [Aspergillus nidulans FGSC A4] Length = 93 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 38 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 93 >ref|XP_385667.1| H4_NEUCR Histone H4 [Fusarium graminearum PH-1] gi|70995986|ref|XP_752748.1| histone H4.1 [Aspergillus fumigatus Af293] gi|85080745|ref|XP_956597.1| histone H4.1 [Neurospora crassa OR74A] gi|115492091|ref|XP_001210673.1| histone H4 [Aspergillus terreus NIH2624] gi|119495181|ref|XP_001264381.1| histone h4 [Neosartorya fischeri NRRL 181] gi|121701227|ref|XP_001268878.1| histone h4 [Aspergillus clavatus NRRL 1] gi|145240325|ref|XP_001392809.1| histone H4 [Aspergillus niger CBS 513.88] gi|154315653|ref|XP_001557149.1| histone H4 [Botryotinia fuckeliana B05.10] gi|156033099|ref|XP_001585386.1| histone H4.1 [Sclerotinia sclerotiorum 1980] gi|156047839|ref|XP_001589887.1| histone H4 [Sclerotinia sclerotiorum 1980] gi|164428072|ref|XP_956002.2| histone H4 [Neurospora crassa OR74A] gi|169600931|ref|XP_001793888.1| hypothetical protein SNOG_03320 [Phaeosphaeria nodorum SN15] gi|189211119|ref|XP_001941890.1| histone H4 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|242774422|ref|XP_002478437.1| histone H4.1 [Talaromyces stipitatus ATCC 10500] gi|261200851|ref|XP_002626826.1| histone h4 [Ajellomyces dermatitidis SLH14081] gi|295660612|ref|XP_002790862.1| histone H4.1 [Paracoccidioides sp. 'lutzii' Pb01] gi|296415900|ref|XP_002837622.1| hypothetical protein [Tuber melanosporum Mel28] gi|296418583|ref|XP_002838910.1| hypothetical protein [Tuber melanosporum Mel28] gi|330930061|ref|XP_003302877.1| hypothetical protein PTT_14861 [Pyrenophora teres f. teres 0-1] gi|336263220|ref|XP_003346390.1| hypothetical protein SMAC_05286 [Sordaria macrospora k-hell] gi|336271871|ref|XP_003350693.1| hypothetical protein SMAC_02364 [Sordaria macrospora k-hell] gi|396499280|ref|XP_003845435.1| hypothetical protein LEMA_P007430.1 [Leptosphaeria maculans JN3] gi|398396842|ref|XP_003851879.1| histone H4 [Zymoseptoria tritici IPO323] gi|597578499|ref|XP_007292306.1| histone H4.1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|597584495|ref|XP_007295304.1| histone H4.1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|615408277|ref|XP_007582608.1| putative histone h4 protein [Neofusicoccum parvum UCRNP2] gi|122099|sp|P04914.2|H4_NEUCR RecName: Full=Histone H4 gi|51315758|sp|Q711M0.3|H41_PENFN RecName: Full=Histone H4.1 gi|74662392|sp|Q7LKT3.3|H4_ASPFU RecName: Full=Histone H4 gi|3018|emb|CAA25760.1| histone H4 [Neurospora crassa] gi|17644132|gb|AAL38972.1| histone H4 [Neurospora crassa] gi|17644135|gb|AAL38974.1| histone H4 [Neurospora crassa] gi|18307449|emb|CAD21509.1| histone H4 [Neurospora crassa] gi|20145254|emb|CAD29611.1| histone h4, putative [Aspergillus fumigatus] gi|21322638|emb|CAC85656.1| histone H4.1 [Talaromyces funiculosus] gi|28917667|gb|EAA27361.1| histone h4 [Neurospora crassa OR74A] gi|66850383|gb|EAL90710.1| histone H4.1 [Aspergillus fumigatus Af293] gi|114197533|gb|EAU39233.1| histone H4 [Aspergillus terreus NIH2624] gi|119397021|gb|EAW07452.1| histone h4 [Aspergillus clavatus NRRL 1] gi|119412543|gb|EAW22484.1| histone h4 [Neosartorya fischeri NRRL 181] gi|134077325|emb|CAK45664.1| unnamed protein product [Aspergillus niger] gi|154694004|gb|EDN93742.1| histone H4 [Sclerotinia sclerotiorum 1980 UF-70] gi|154699028|gb|EDN98766.1| histone H4.1 [Sclerotinia sclerotiorum 1980 UF-70] gi|157071999|gb|EAA26766.2| histone h4 [Neurospora crassa OR74A] gi|159131502|gb|EDP56615.1| histone H4.1 [Aspergillus fumigatus A1163] gi|160705549|gb|EAT90051.2| hypothetical protein SNOG_03320 [Phaeosphaeria nodorum SN15] gi|187977983|gb|EDU44609.1| histone H4 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|218722056|gb|EED21474.1| histone H4.1 [Talaromyces stipitatus ATCC 10500] gi|225681900|gb|EEH20184.1| histone H4 [Paracoccidioides brasiliensis Pb03] gi|226281114|gb|EEH36680.1| histone H4.1 [Paracoccidioides sp. 'lutzii' Pb01] gi|226289071|gb|EEH44583.1| histone H4 [Paracoccidioides brasiliensis Pb18] gi|239593898|gb|EEQ76479.1| histone h4 [Ajellomyces dermatitidis SLH14081] gi|239607231|gb|EEQ84218.1| histone h4 [Ajellomyces dermatitidis ER-3] gi|295633498|emb|CAZ81813.1| unnamed protein product [Tuber melanosporum] gi|295634893|emb|CAZ83101.1| unnamed protein product [Tuber melanosporum] gi|311321505|gb|EFQ89053.1| hypothetical protein PTT_14861 [Pyrenophora teres f. teres 0-1] gi|312222016|emb|CBY01956.1| hypothetical protein LEMA_P007430.1 [Leptosphaeria maculans JN3] gi|327351190|gb|EGE80047.1| histone H4 [Ajellomyces dermatitidis ATCC 18188] gi|335345844|gb|AEH41502.1| histone H4 [Endocarpon pusillum] gi|336468273|gb|EGO56436.1| hypothetical protein NEUTE1DRAFT_130393 [Neurospora tetrasperma FGSC 2508] gi|336469747|gb|EGO57909.1| hypothetical protein NEUTE1DRAFT_63263 [Neurospora tetrasperma FGSC 2508] gi|339471759|gb|EGP86855.1| histone H4 [Zymoseptoria tritici IPO323] gi|342887285|gb|EGU86826.1| hypothetical protein FOXB_02653 [Fusarium oxysporum Fo5176] gi|345562783|gb|EGX45796.1| hypothetical protein AOL_s00117g1 [Arthrobotrys oligospora ATCC 24927] gi|345569012|gb|EGX51881.1| hypothetical protein AOL_s00043g615 [Arthrobotrys oligospora ATCC 24927] gi|347840061|emb|CCD54633.1| hypothetical protein BofuT4_P126810.1 [Botryotinia fuckeliana T4] gi|350289474|gb|EGZ70699.1| histone-fold-containing protein [Neurospora tetrasperma FGSC 2509] gi|350290590|gb|EGZ71804.1| histone-fold-containing protein [Neurospora tetrasperma FGSC 2509] gi|350629858|gb|EHA18231.1| H4 histone 4 protein [Aspergillus niger ATCC 1015] gi|358370856|dbj|GAA87466.1| histone H4 [Aspergillus kawachii IFO 4308] gi|361130113|gb|EHL01967.1| putative Histone H4 [Glarea lozoyensis 74030] gi|378727170|gb|EHY53629.1| hypothetical protein HMPREF1120_01817 [Exophiala dermatitidis NIH/UT8656] gi|380089902|emb|CCC12212.1| unnamed protein product [Sordaria macrospora k-hell] gi|380094855|emb|CCC07357.1| unnamed protein product [Sordaria macrospora k-hell] gi|406861640|gb|EKD14694.1| histone H4.1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406864511|gb|EKD17556.1| histone H4.1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|407924640|gb|EKG17673.1| Histone H4 [Macrophomina phaseolina MS6] gi|408395817|gb|EKJ74990.1| hypothetical protein FPSE_04810 [Fusarium pseudograminearum CS3096] gi|408397106|gb|EKJ76256.1| hypothetical protein FPSE_03511 [Fusarium pseudograminearum CS3096] gi|440635902|gb|ELR05821.1| hypothetical protein GMDG_01898 [Pseudogymnoascus destructans 20631-21] gi|440639077|gb|ELR08996.1| hypothetical protein GMDG_00614 [Pseudogymnoascus destructans 20631-21] gi|449299647|gb|EMC95660.1| hypothetical protein BAUCODRAFT_34429 [Baudoinia compniacensis UAMH 10762] gi|451853151|gb|EMD66445.1| hypothetical protein COCSADRAFT_34964 [Bipolaris sorokiniana ND90Pr] gi|452840171|gb|EME42109.1| hypothetical protein DOTSEDRAFT_45666 [Dothistroma septosporum NZE10] gi|453084893|gb|EMF12937.1| histone-fold-containing protein [Sphaerulina musiva SO2202] gi|472245006|gb|EMR89599.1| putative histone h4 protein [Botryotinia fuckeliana BcDW1] gi|475664561|gb|EMT62355.1| Histone H4 [Fusarium oxysporum f. sp. cubense race 4] gi|475673106|gb|EMT70229.1| Histone H4 [Fusarium oxysporum f. sp. cubense race 4] gi|477521053|gb|ENH73172.1| Histone H4 [Fusarium oxysporum f. sp. cubense race 1] gi|477522110|gb|ENH74192.1| Histone H4 [Fusarium oxysporum f. sp. cubense race 1] gi|482808060|gb|EOA84993.1| hypothetical protein SETTUDRAFT_163757 [Setosphaeria turcica Et28A] gi|485925323|gb|EOD49946.1| putative histone h4 protein [Neofusicoccum parvum UCRNP2] gi|494828794|gb|EON65579.1| hypothetical protein W97_04817 [Coniosporium apollinis CBS 100218] gi|512196954|gb|EPE25790.1| Histone-fold containing protein [Glarea lozoyensis ATCC 20868] gi|512199128|gb|EPE27962.1| Histone-fold containing protein [Glarea lozoyensis ATCC 20868] gi|517320747|emb|CCT71865.1| probable histone H4 [Fusarium fujikuroi IMI 58289] gi|517323403|emb|CCT74117.1| histone H4 [Fusarium fujikuroi IMI 58289] gi|521775876|gb|EPQ66783.1| histone H4 protein [Blumeria graminis f. sp. tritici 96224] gi|526201048|gb|EPS41637.1| hypothetical protein H072_4461 [Dactylellina haptotyla CBS 200.50] gi|528289744|emb|CCU82906.1| Histone H4 [Blumeria graminis f. sp. hordei DH14] gi|528293706|emb|CCU81214.1| Histone H4 [Blumeria graminis f. sp. hordei DH14] gi|531983756|gb|EQL34343.1| histone H4 [Ajellomyces dermatitidis ATCC 26199] gi|539439790|gb|ERF75304.1| Histone H4 [Endocarpon pusillum Z07020] gi|549047118|emb|CCX13617.1| Similar to Histone H4.1; acc. no. P23750 [Pyronema omphalodes CBS 100304] gi|549055592|emb|CCX05635.1| Similar to Histone H4.1; acc. no. P23750 [Pyronema omphalodes CBS 100304] gi|557723175|dbj|GAD98062.1| hypothetical protein PVAR5_6750 [Byssochlamys spectabilis No. 5] gi|558858746|gb|ESU08829.1| hypothetical protein FGSG_04289 [Fusarium graminearum PH-1] gi|558861377|gb|ESU11460.1| hypothetical protein FGSG_05491 [Fusarium graminearum PH-1] gi|563288566|gb|ESZ89535.1| histone H4 [Sclerotinia borealis F-4157] gi|563294417|gb|ESZ94720.1| histone H4 [Sclerotinia borealis F-4157] gi|565936490|gb|ETI25693.1| histone [Cladophialophora carrionii CBS 160.54] gi|582957933|gb|EWC46146.1| histone H4 [Drechslerella stenobrocha 248] gi|582958758|gb|EWC46963.1| histone H4 [Drechslerella stenobrocha 248] gi|584137270|gb|EWG46616.1| histone H4 [Fusarium verticillioides 7600] gi|584143425|gb|EWG52728.1| histone H4 [Fusarium verticillioides 7600] gi|587662694|gb|EWY85035.1| histone H4 [Fusarium oxysporum FOSC 3-a] gi|587664465|gb|EWY86806.1| histone H4 [Fusarium oxysporum FOSC 3-a] gi|587688276|gb|EWZ34881.1| histone H4 [Fusarium oxysporum Fo47] gi|587688877|gb|EWZ35482.1| histone H4 [Fusarium oxysporum Fo47] gi|587723684|gb|EWZ95021.1| histone H4 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587725183|gb|EWZ96520.1| histone H4 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587739893|gb|EXA37609.1| histone H4 [Fusarium oxysporum f. sp. pisi HDV247] gi|587741126|gb|EXA38842.1| histone H4 [Fusarium oxysporum f. sp. pisi HDV247] gi|589973951|gb|EXJ57269.1| histone H4 [Cladophialophora yegresii CBS 114405] gi|589992908|gb|EXJ75490.1| histone H4 [Cladophialophora psammophila CBS 110553] gi|590033293|gb|EXK35151.1| histone H4 [Fusarium oxysporum f. sp. melonis 26406] gi|590035672|gb|EXK37530.1| histone H4 [Fusarium oxysporum f. sp. melonis 26406] gi|590058850|gb|EXK86374.1| histone H4 [Fusarium oxysporum f. sp. raphani 54005] gi|590067476|gb|EXK95000.1| histone H4 [Fusarium oxysporum f. sp. raphani 54005] gi|591413461|gb|EXL48598.1| histone H4 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591419884|gb|EXL55021.1| histone H4 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591447026|gb|EXL79478.1| histone H4 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591454283|gb|EXL86542.1| histone H4 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591473961|gb|EXM05173.1| histone H4 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591474702|gb|EXM05891.1| histone H4 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591495372|gb|EXM24896.1| histone H4 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591501688|gb|EXM31072.1| histone H4 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596544888|gb|EYB25008.1| hypothetical protein FG05_05491 [Fusarium graminearum] gi|596546281|gb|EYB26281.1| hypothetical protein FG05_30375 [Fusarium graminearum] Length = 103 Score = 113 bits (282), Expect = 3e-23 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 48 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103 >gb|ETS00204.1| histone-fold-containing protein [Trichoderma reesei RUT C-30] Length = 103 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 48 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103 >gb|AAW69330.1| histone H4-like protein [Magnaporthe grisea] Length = 103 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 48 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103 >ref|XP_003667082.1| H4-like protein, partial [Myceliophthora thermophila ATCC 42464] gi|347014355|gb|AEO61837.1| H4-like protein, partial [Myceliophthora thermophila ATCC 42464] Length = 92 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 37 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 92 >ref|XP_003655325.1| histone H4-like protein, partial [Thielavia terrestris NRRL 8126] gi|347002589|gb|AEO68989.1| histone H4-like protein, partial [Thielavia terrestris NRRL 8126] Length = 99 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 44 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 99 >ref|XP_001910030.1| hypothetical protein [Podospora anserina S mat+] gi|170945053|emb|CAP71164.1| unnamed protein product [Podospora anserina S mat+] Length = 300 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 245 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 300 >ref|XP_001548661.1| histone H4 [Botryotinia fuckeliana B05.10] gi|171685646|ref|XP_001907764.1| hypothetical protein [Podospora anserina S mat+] gi|302410823|ref|XP_003003245.1| histone H4.1 [Verticillium alfalfae VaMs.102] gi|302418914|ref|XP_003007288.1| histone H4.2 [Verticillium alfalfae VaMs.102] gi|367028140|ref|XP_003663354.1| histone H4-like protein [Myceliophthora thermophila ATCC 42464] gi|367055132|ref|XP_003657944.1| histone H4-like protein [Thielavia terrestris NRRL 8126] gi|389639324|ref|XP_003717295.1| histone H4 [Magnaporthe oryzae 70-15] gi|389640257|ref|XP_003717761.1| histone H4 [Magnaporthe oryzae 70-15] gi|589111005|ref|XP_006967525.1| histone H4 [Trichoderma reesei QM6a] gi|589115505|ref|XP_006969775.1| histone H4 [Trichoderma reesei QM6a] gi|596663542|ref|XP_007275571.1| histone h4 [Colletotrichum gloeosporioides Nara gc5] gi|596702145|ref|XP_007282760.1| histone h4 [Colletotrichum gloeosporioides Nara gc5] gi|615406823|ref|XP_007582138.1| putative histone h4 protein [Neofusicoccum parvum UCRNP2] gi|615448825|ref|XP_007594113.1| histone H4.1 [Colletotrichum fioriniae PJ7] gi|170942784|emb|CAP68437.1| unnamed protein product [Podospora anserina S mat+] gi|225560317|gb|EEH08599.1| histone H4 [Ajellomyces capsulatus G186AR] gi|240278755|gb|EER42261.1| histone H4 [Ajellomyces capsulatus H143] gi|261354890|gb|EEY17318.1| histone H4.2 [Verticillium alfalfae VaMs.102] gi|261358269|gb|EEY20697.1| histone H4.1 [Verticillium alfalfae VaMs.102] gi|310789503|gb|EFQ25036.1| histone H4 [Colletotrichum graminicola M1.001] gi|310798571|gb|EFQ33464.1| histone H4 [Colletotrichum graminicola M1.001] gi|325090335|gb|EGC43645.1| histone H4 [Ajellomyces capsulatus H88] gi|340514006|gb|EGR44277.1| histone H4 [Trichoderma reesei QM6a] gi|340516395|gb|EGR46644.1| histone H4 [Trichoderma reesei QM6a] gi|346971255|gb|EGY14707.1| histone H4.2 [Verticillium dahliae VdLs.17] gi|346976955|gb|EGY20407.1| histone H4.1 [Verticillium dahliae VdLs.17] gi|347005210|gb|AEO71608.1| histone H4-like protein [Thielavia terrestris NRRL 8126] gi|347010623|gb|AEO58109.1| histone H4-like protein [Myceliophthora thermophila ATCC 42464] gi|347831215|emb|CCD46912.1| hypothetical protein BofuT4_P038140.1 [Botryotinia fuckeliana T4] gi|351640314|gb|EHA48177.1| histone H4 [Magnaporthe oryzae 70-15] gi|351643114|gb|EHA50976.1| histone H4 [Magnaporthe oryzae 70-15] gi|358379357|gb|EHK17037.1| hypothetical protein TRIVIDRAFT_216891 [Trichoderma virens Gv29-8] gi|358380110|gb|EHK17789.1| hypothetical protein TRIVIDRAFT_88786 [Trichoderma virens Gv29-8] gi|358398121|gb|EHK47479.1| hypothetical protein TRIATDRAFT_255937 [Trichoderma atroviride IMI 206040] gi|358399049|gb|EHK48392.1| hypothetical protein TRIATDRAFT_297966 [Trichoderma atroviride IMI 206040] gi|380492198|emb|CCF34779.1| histone H4 [Colletotrichum higginsianum] gi|380492527|emb|CCF34535.1| histone H4 [Colletotrichum higginsianum] gi|402077277|gb|EJT72626.1| histone H4 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402078177|gb|EJT73526.1| histone H4 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|407921883|gb|EKG15020.1| Histone H4 [Macrophomina phaseolina MS6] gi|429853056|gb|ELA28155.1| histone h4 [Colletotrichum gloeosporioides Nara gc5] gi|429860699|gb|ELA35425.1| histone h4 [Colletotrichum gloeosporioides Nara gc5] gi|440468878|gb|ELQ38012.1| histone H4.1 [Magnaporthe oryzae Y34] gi|440471841|gb|ELQ40775.1| hypothetical protein OOU_Y34scaffold00359g2 [Magnaporthe oryzae Y34] gi|440480929|gb|ELQ61561.1| histone H4.1 [Magnaporthe oryzae P131] gi|440483989|gb|ELQ64196.1| hypothetical protein OOW_P131scaffold00746g2 [Magnaporthe oryzae P131] gi|471558975|gb|EMR61500.1| putative histone h4 protein [Eutypa lata UCREL1] gi|471564433|gb|EMR65366.1| putative histone h4 protein [Eutypa lata UCREL1] gi|472237485|gb|EMR82378.1| putative histone h4 protein [Botryotinia fuckeliana BcDW1] gi|477529262|gb|ENH81026.1| histone h4 [Colletotrichum orbiculare MAFF 240422] gi|477535505|gb|ENH87018.1| histone h4 [Colletotrichum orbiculare MAFF 240422] gi|485925939|gb|EOD50379.1| putative histone h4 protein [Neofusicoccum parvum UCRNP2] gi|494828840|gb|EON65598.1| histone H4 [Coniosporium apollinis CBS 100218] gi|500254520|gb|EON98116.1| putative histone h4 protein [Togninia minima UCRPA7] gi|500262040|gb|EOO04316.1| putative histone h4 protein [Togninia minima UCRPA7] gi|512187386|gb|EPE03166.1| histone h4 [Ophiostoma piceae UAMH 11346] gi|512192046|gb|EPE07806.1| histone h4 [Ophiostoma piceae UAMH 11346] gi|530460349|gb|EQB43692.1| histone H4 [Colletotrichum gloeosporioides Cg-14] gi|530479436|gb|EQB58627.1| histone H4 [Colletotrichum gloeosporioides Cg-14] gi|531857311|gb|EQK97973.1| Histone H4 [Ophiocordyceps sinensis CO18] gi|531857731|gb|EQK98097.1| Histone H4 [Ophiocordyceps sinensis CO18] gi|550803074|gb|ERS95000.1| histone [Sporothrix schenckii ATCC 58251] gi|572273334|gb|ETR96985.1| histone-fold-containing protein [Trichoderma reesei RUT C-30] gi|573060733|gb|ETS80495.1| Histone H4 [Pestalotiopsis fici W106-1] gi|573062601|gb|ETS82309.1| Histone H4 [Pestalotiopsis fici W106-1] gi|588901784|gb|EXF82210.1| histone H4.1 [Colletotrichum fioriniae PJ7] Length = 103 Score = 111 bits (278), Expect = 9e-23 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLK+FLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 48 SAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103 >gb|EUN23284.1| hypothetical protein COCVIDRAFT_29861 [Bipolaris victoriae FI3] Length = 119 Score = 110 bits (276), Expect = 2e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLE VIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 64 SAMIYEETRGVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 119 >gb|EUC48318.1| hypothetical protein COCMIDRAFT_2761 [Bipolaris oryzae ATCC 44560] Length = 119 Score = 110 bits (276), Expect = 2e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLE VIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 64 SAMIYEETRGVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 119 >gb|EUC27673.1| hypothetical protein COCCADRAFT_9791 [Bipolaris zeicola 26-R-13] Length = 119 Score = 110 bits (276), Expect = 2e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLE VIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 64 SAMIYEETRGVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 119 >gb|ENI00941.1| hypothetical protein COCC4DRAFT_149394, partial [Bipolaris maydis ATCC 48331] Length = 99 Score = 110 bits (276), Expect = 2e-22 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 379 SAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 212 SAMIYEETRGVLKTFLE VIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG Sbjct: 44 SAMIYEETRGVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 99