BLASTX nr result
ID: Sinomenium21_contig00025874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00025874 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56450.1| Transcription initiation factor TFIID subunit 11 ... 76 6e-12 ref|XP_002532706.1| Transcription initiation factor TFIID subuni... 76 6e-12 ref|XP_002299376.1| transcription initiation factor IID 28 kDa s... 76 6e-12 ref|XP_006413886.1| hypothetical protein EUTSA_v10026240mg [Eutr... 75 1e-11 gb|EMT32936.1| Transcription initiation factor TFIID subunit 11 ... 75 1e-11 ref|XP_003569565.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006468617.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006468615.1| PREDICTED: transcription initiation factor T... 74 2e-11 ref|XP_006285330.1| hypothetical protein CARUB_v10006719mg [Caps... 74 2e-11 ref|NP_193761.1| TBP-associated factor 11 [Arabidopsis thaliana]... 74 2e-11 ref|XP_002869942.1| predicted protein [Arabidopsis lyrata subsp.... 74 2e-11 emb|CAA18253.1| putative protein [Arabidopsis thaliana] gi|72688... 74 2e-11 gb|ACN30761.1| unknown [Zea mays] 74 3e-11 ref|NP_001152593.1| transcription initiation factor TFIID subuni... 74 3e-11 ref|NP_001151617.1| transcription initiation factor TFIID subuni... 74 3e-11 ref|XP_006448556.1| hypothetical protein CICLE_v10016661mg [Citr... 73 4e-11 ref|XP_004969544.1| PREDICTED: transcription initiation factor T... 73 4e-11 ref|XP_002456149.1| hypothetical protein SORBIDRAFT_03g031220 [S... 73 4e-11 ref|XP_006644523.1| PREDICTED: transcription initiation factor T... 72 1e-10 ref|XP_007211979.1| hypothetical protein PRUPE_ppa010895mg [Prun... 72 1e-10 >gb|EXB56450.1| Transcription initiation factor TFIID subunit 11 [Morus notabilis] Length = 253 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M+ERKESGP+RP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 216 MSERKESGPVRPCHIREAYRRLKLEGKVPKRSVPRLFR 253 >ref|XP_002532706.1| Transcription initiation factor TFIID subunit, putative [Ricinus communis] gi|223527552|gb|EEF29673.1| Transcription initiation factor TFIID subunit, putative [Ricinus communis] Length = 205 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 168 MTERKESGPIRPCHIREAYRRLKLEGKVPKRSVPRLFR 205 >ref|XP_002299376.1| transcription initiation factor IID 28 kDa subunit family protein [Populus trichocarpa] gi|222846634|gb|EEE84181.1| transcription initiation factor IID 28 kDa subunit family protein [Populus trichocarpa] Length = 222 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 185 MTERKESGPIRPCHIREAYRRLKLEGKVPKRSVPRLFR 222 >ref|XP_006413886.1| hypothetical protein EUTSA_v10026240mg [Eutrema salsugineum] gi|557115056|gb|ESQ55339.1| hypothetical protein EUTSA_v10026240mg [Eutrema salsugineum] Length = 210 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIRE+YRRLKLEGKVPKRSVPRLFR Sbjct: 173 MGERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR 210 >gb|EMT32936.1| Transcription initiation factor TFIID subunit 11 [Aegilops tauschii] Length = 137 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M+ERK+SGPIRP HIREAYRRLKLEGK+PKRSVPRLFR Sbjct: 100 MSERKDSGPIRPCHIREAYRRLKLEGKIPKRSVPRLFR 137 >ref|XP_003569565.1| PREDICTED: transcription initiation factor TFIID subunit 11-like [Brachypodium distachyon] Length = 216 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERK+SGPIRP HIREAYRRLKLEGK+PKRSVPRLFR Sbjct: 179 MTERKDSGPIRPCHIREAYRRLKLEGKIPKRSVPRLFR 216 >ref|XP_006468617.1| PREDICTED: transcription initiation factor TFIID subunit 11-like isoform X3 [Citrus sinensis] Length = 210 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ER ESGPIRP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 173 MTERNESGPIRPCHIREAYRRLKLEGKVPKRSVPRLFR 210 >ref|XP_006468615.1| PREDICTED: transcription initiation factor TFIID subunit 11-like isoform X1 [Citrus sinensis] Length = 216 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ER ESGPIRP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 179 MTERNESGPIRPCHIREAYRRLKLEGKVPKRSVPRLFR 216 >ref|XP_006285330.1| hypothetical protein CARUB_v10006719mg [Capsella rubella] gi|482554035|gb|EOA18228.1| hypothetical protein CARUB_v10006719mg [Capsella rubella] Length = 208 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIRE+YRRLKLEGKVPKRSVPRLFR Sbjct: 171 MAERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR 208 >ref|NP_193761.1| TBP-associated factor 11 [Arabidopsis thaliana] gi|75264738|sp|Q9M565.1|TAF11_ARATH RecName: Full=Transcription initiation factor TFIID subunit 11; AltName: Full=TBP-associated factor 11; Short=AtTAF11 gi|7638155|gb|AAF65405.1|AF238326_1 putative TATA binding protein associated factor 24kDa subunit [Arabidopsis thaliana] gi|13877757|gb|AAK43956.1|AF370141_1 unknown protein [Arabidopsis thaliana] gi|15293301|gb|AAK93761.1| unknown protein [Arabidopsis thaliana] gi|39545902|gb|AAR28014.1| TAF11 [Arabidopsis thaliana] gi|332658898|gb|AEE84298.1| TBP-associated factor 11 [Arabidopsis thaliana] Length = 210 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIRE+YRRLKLEGKVPKRSVPRLFR Sbjct: 173 MAERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR 210 >ref|XP_002869942.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297315778|gb|EFH46201.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 211 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIRE+YRRLKLEGKVPKRSVPRLFR Sbjct: 174 MAERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR 211 >emb|CAA18253.1| putative protein [Arabidopsis thaliana] gi|7268823|emb|CAB79028.1| putative protein [Arabidopsis thaliana] Length = 221 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIRE+YRRLKLEGKVPKRSVPRLFR Sbjct: 184 MAERKESGPIRPCHIRESYRRLKLEGKVPKRSVPRLFR 221 >gb|ACN30761.1| unknown [Zea mays] Length = 203 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M+ERK+SGPIRP HIREAYRRLKLEGK+P+RSVPRLFR Sbjct: 166 MSERKDSGPIRPCHIREAYRRLKLEGKIPRRSVPRLFR 203 >ref|NP_001152593.1| transcription initiation factor TFIID subunit 11 [Zea mays] gi|195657891|gb|ACG48413.1| transcription initiation factor TFIID subunit 11 [Zea mays] gi|414880994|tpg|DAA58125.1| TPA: transcription initiation factor TFIID subunit 11 [Zea mays] Length = 205 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M+ERK+SGPIRP HIREAYRRLKLEGK+P+RSVPRLFR Sbjct: 168 MSERKDSGPIRPCHIREAYRRLKLEGKIPRRSVPRLFR 205 >ref|NP_001151617.1| transcription initiation factor TFIID subunit 11 [Zea mays] gi|195648128|gb|ACG43532.1| transcription initiation factor TFIID subunit 11 [Zea mays] Length = 205 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M+ERK+SGPIRP HIREAYRRLKLEGK+P+RSVPRLFR Sbjct: 168 MSERKDSGPIRPCHIREAYRRLKLEGKIPRRSVPRLFR 205 >ref|XP_006448556.1| hypothetical protein CICLE_v10016661mg [Citrus clementina] gi|557551167|gb|ESR61796.1| hypothetical protein CICLE_v10016661mg [Citrus clementina] Length = 216 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ER ESGPIRP HIREAYRRLKLEGKVPKRSVPRLFR Sbjct: 179 MMERNESGPIRPCHIREAYRRLKLEGKVPKRSVPRLFR 216 >ref|XP_004969544.1| PREDICTED: transcription initiation factor TFIID subunit 11-like [Setaria italica] Length = 207 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERK+SGPIRP HIREAYRRLKLEGK+P+RSVPRLFR Sbjct: 170 MTERKDSGPIRPCHIREAYRRLKLEGKIPRRSVPRLFR 207 >ref|XP_002456149.1| hypothetical protein SORBIDRAFT_03g031220 [Sorghum bicolor] gi|241928124|gb|EES01269.1| hypothetical protein SORBIDRAFT_03g031220 [Sorghum bicolor] Length = 209 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERK+SGPIRP HIREAYRRLKLEGK+P+RSVPRLFR Sbjct: 172 MTERKDSGPIRPCHIREAYRRLKLEGKIPRRSVPRLFR 209 >ref|XP_006644523.1| PREDICTED: transcription initiation factor TFIID subunit 11-like [Oryza brachyantha] Length = 188 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERK+SGP+RP HIREAYRRLKLEGK+P+R+VPRLFR Sbjct: 151 MTERKDSGPVRPCHIREAYRRLKLEGKIPRRTVPRLFR 188 >ref|XP_007211979.1| hypothetical protein PRUPE_ppa010895mg [Prunus persica] gi|462407844|gb|EMJ13178.1| hypothetical protein PRUPE_ppa010895mg [Prunus persica] Length = 231 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 340 MNERKESGPIRPSHIREAYRRLKLEGKVPKRSVPRLFR 227 M ERKESGPIRP HIREAYRRLKLEGKVPKRS+ RLFR Sbjct: 194 MTERKESGPIRPCHIREAYRRLKLEGKVPKRSMSRLFR 231