BLASTX nr result
ID: Sinomenium21_contig00025196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00025196 (548 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containi... 69 8e-10 >ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vitis vinifera] Length = 641 Score = 68.9 bits (167), Expect = 8e-10 Identities = 45/99 (45%), Positives = 57/99 (57%), Gaps = 1/99 (1%) Frame = +2 Query: 254 NGVQFQMTLFLLPTSLSRVLLAASRTLFVASFHDHAVQVCSQPDFRSSNR-EVIQNTDAW 430 +GV QMTL L T SRV + + +A FH+HAV + S NR EVIQN + W Sbjct: 27 DGVALQMTLLLFITRPSRV---RASKIAIAQFHEHAVGI-------SRNRPEVIQNPENW 76 Query: 431 IVKVVSTLCLLRGSKSSTDFFTCLEYFSKSFNPSIVFGV 547 IVKV+ TLC+ S + CL+YFSK+ PSI F V Sbjct: 77 IVKVICTLCVRTHSLDA-----CLDYFSKTLTPSIAFEV 110