BLASTX nr result
ID: Sinomenium21_contig00024963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024963 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006402336.1| hypothetical protein EUTSA_v10006266mg [Eutr... 126 4e-27 ref|XP_006402335.1| hypothetical protein EUTSA_v10006266mg [Eutr... 126 4e-27 ref|XP_006397960.1| hypothetical protein EUTSA_v10001688mg [Eutr... 126 4e-27 ref|XP_006397961.1| hypothetical protein EUTSA_v10001688mg [Eutr... 126 4e-27 ref|XP_004960522.1| PREDICTED: small nuclear ribonucleoprotein S... 126 4e-27 ref|XP_007202787.1| hypothetical protein PRUPE_ppa013723mg [Prun... 126 4e-27 ref|XP_007201901.1| hypothetical protein PRUPE_ppa013707mg [Prun... 126 4e-27 ref|XP_004247417.1| PREDICTED: probable small nuclear ribonucleo... 126 4e-27 ref|NP_850477.1| small nuclear ribonucleoprotein D2 [Arabidopsis... 126 4e-27 ref|XP_002878480.1| predicted protein [Arabidopsis lyrata subsp.... 126 4e-27 ref|NP_566107.1| small nuclear ribonucleoprotein D2 [Arabidopsis... 126 4e-27 ref|XP_002880318.1| hypothetical protein ARALYDRAFT_483945 [Arab... 126 4e-27 gb|AFW58868.1| hypothetical protein ZEAMMB73_850141 [Zea mays] 125 6e-27 ref|NP_001131740.1| uncharacterized protein LOC100193106 [Zea ma... 125 6e-27 ref|XP_006588396.1| PREDICTED: uncharacterized protein LOC100500... 125 8e-27 ref|XP_007131373.1| hypothetical protein PHAVU_011G008300g [Phas... 125 8e-27 ref|XP_006855556.1| hypothetical protein AMTR_s00057p00221440 [A... 125 8e-27 ref|XP_004976243.1| PREDICTED: small nuclear ribonucleoprotein S... 125 8e-27 ref|XP_004971389.1| PREDICTED: small nuclear ribonucleoprotein S... 125 8e-27 ref|XP_004976244.1| PREDICTED: small nuclear ribonucleoprotein S... 125 8e-27 >ref|XP_006402336.1| hypothetical protein EUTSA_v10006266mg [Eutrema salsugineum] gi|557103435|gb|ESQ43789.1| hypothetical protein EUTSA_v10006266mg [Eutrema salsugineum] Length = 178 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 91 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 150 >ref|XP_006402335.1| hypothetical protein EUTSA_v10006266mg [Eutrema salsugineum] gi|557103434|gb|ESQ43788.1| hypothetical protein EUTSA_v10006266mg [Eutrema salsugineum] Length = 177 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 90 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 149 >ref|XP_006397960.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] gi|567166912|ref|XP_006397962.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] gi|557099033|gb|ESQ39413.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] gi|557099035|gb|ESQ39415.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] Length = 109 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 22 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 81 >ref|XP_006397961.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] gi|557099034|gb|ESQ39414.1| hypothetical protein EUTSA_v10001688mg [Eutrema salsugineum] Length = 108 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 21 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 80 >ref|XP_004960522.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X1 [Setaria italica] gi|514743998|ref|XP_004960523.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X2 [Setaria italica] Length = 104 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 17 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 76 >ref|XP_007202787.1| hypothetical protein PRUPE_ppa013723mg [Prunus persica] gi|462398318|gb|EMJ03986.1| hypothetical protein PRUPE_ppa013723mg [Prunus persica] Length = 107 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 20 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 79 >ref|XP_007201901.1| hypothetical protein PRUPE_ppa013707mg [Prunus persica] gi|462397301|gb|EMJ03100.1| hypothetical protein PRUPE_ppa013707mg [Prunus persica] Length = 107 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 20 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 79 >ref|XP_004247417.1| PREDICTED: probable small nuclear ribonucleoprotein Sm D2-like [Solanum lycopersicum] gi|565387163|ref|XP_006359373.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like [Solanum tuberosum] Length = 109 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 22 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 81 >ref|NP_850477.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|42571273|ref|NP_973710.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|145332931|ref|NP_001078331.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|565475276|ref|XP_006295279.1| hypothetical protein CARUB_v10024367mg [Capsella rubella] gi|7362764|emb|CAB83134.1| small nuclear ribonucleoprotein-like protein [Arabidopsis thaliana] gi|28466881|gb|AAO44049.1| At2g47640 [Arabidopsis thaliana] gi|110743879|dbj|BAE99774.1| putative small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|330255774|gb|AEC10868.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|330255775|gb|AEC10869.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|332646880|gb|AEE80401.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|482563987|gb|EOA28177.1| hypothetical protein CARUB_v10024367mg [Capsella rubella] Length = 108 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 21 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 80 >ref|XP_002878480.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324318|gb|EFH54739.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 109 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 22 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 81 >ref|NP_566107.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|145331435|ref|NP_001078076.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|145339793|ref|NP_567134.3| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|565475278|ref|XP_006295280.1| hypothetical protein CARUB_v10024367mg [Capsella rubella] gi|20196966|gb|AAM14847.1| putative small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|20197310|gb|AAC63620.2| putative small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|330255773|gb|AEC10867.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|330255776|gb|AEC10870.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|332646879|gb|AEE80400.1| small nuclear ribonucleoprotein D2 [Arabidopsis thaliana] gi|482563988|gb|EOA28178.1| hypothetical protein CARUB_v10024367mg [Capsella rubella] Length = 109 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 22 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 81 >ref|XP_002880318.1| hypothetical protein ARALYDRAFT_483945 [Arabidopsis lyrata subsp. lyrata] gi|21554692|gb|AAM63661.1| small nuclear ribonucleoprotein-like protein [Arabidopsis thaliana] gi|21592784|gb|AAM64733.1| small nuclear ribonucleoprotein-like protein [Arabidopsis thaliana] gi|297326157|gb|EFH56577.1| hypothetical protein ARALYDRAFT_483945 [Arabidopsis lyrata subsp. lyrata] Length = 105 Score = 126 bits (316), Expect = 4e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 18 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 77 >gb|AFW58868.1| hypothetical protein ZEAMMB73_850141 [Zea mays] Length = 104 Score = 125 bits (314), Expect = 6e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK Sbjct: 17 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 76 >ref|NP_001131740.1| uncharacterized protein LOC100193106 [Zea mays] gi|194692396|gb|ACF80282.1| unknown [Zea mays] gi|195629728|gb|ACG36505.1| small nuclear ribonucleoprotein Sm D2 [Zea mays] gi|413918934|gb|AFW58866.1| Small nuclear ribonucleoprotein Sm D2 isoform 1 [Zea mays] gi|413918935|gb|AFW58867.1| Small nuclear ribonucleoprotein Sm D2 isoform 2 [Zea mays] Length = 105 Score = 125 bits (314), Expect = 6e-27 Identities = 59/60 (98%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK Sbjct: 18 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 77 >ref|XP_006588396.1| PREDICTED: uncharacterized protein LOC100500203 isoform X1 [Glycine max] Length = 108 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 21 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 80 >ref|XP_007131373.1| hypothetical protein PHAVU_011G008300g [Phaseolus vulgaris] gi|561004373|gb|ESW03367.1| hypothetical protein PHAVU_011G008300g [Phaseolus vulgaris] Length = 109 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 22 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 81 >ref|XP_006855556.1| hypothetical protein AMTR_s00057p00221440 [Amborella trichopoda] gi|548859322|gb|ERN17023.1| hypothetical protein AMTR_s00057p00221440 [Amborella trichopoda] Length = 105 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 18 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 77 >ref|XP_004976243.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X1 [Setaria italica] Length = 105 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 18 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 77 >ref|XP_004971389.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X1 [Setaria italica] gi|514787675|ref|XP_004971390.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X2 [Setaria italica] Length = 104 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 17 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 76 >ref|XP_004976244.1| PREDICTED: small nuclear ribonucleoprotein Sm D2-like isoform X2 [Setaria italica] Length = 104 Score = 125 bits (313), Expect = 8e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 181 GPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNMVLENVREMWTEIPKTGKGKKK 2 GPLSVLMMSVKNNTQVLINCRNN+KLLGRVRAFDRHCNMVLENVREMWTE+PKTGKGKKK Sbjct: 17 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKK 76