BLASTX nr result
ID: Sinomenium21_contig00024943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024943 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492116.1| PREDICTED: uncharacterized protein LOC101495... 81 2e-13 gb|AFK39862.1| unknown [Medicago truncatula] 80 4e-13 gb|AFK39044.1| unknown [Medicago truncatula] 80 4e-13 ref|XP_003621863.1| hypothetical protein MTR_7g024320 [Medicago ... 80 4e-13 ref|XP_003621862.1| hypothetical protein MTR_7g024320 [Medicago ... 80 4e-13 gb|ACJ84336.1| unknown [Medicago truncatula] 80 4e-13 ref|XP_006411185.1| hypothetical protein EUTSA_v10016727mg [Eutr... 79 5e-13 ref|XP_002879806.1| ACT domain-containing protein [Arabidopsis l... 79 7e-13 gb|AAK74028.1| At2g39570/F12L6.23 [Arabidopsis thaliana] gi|2330... 79 7e-13 ref|NP_565908.1| ACT domain-containing protein [Arabidopsis thal... 79 7e-13 ref|XP_006294312.1| hypothetical protein CARUB_v10023319mg [Caps... 78 1e-12 ref|XP_002312081.1| ACT domain-containing family protein [Populu... 77 2e-12 ref|XP_006436032.1| hypothetical protein CICLE_v10031651mg [Citr... 76 4e-12 ref|XP_002298369.1| ACT domain-containing family protein [Populu... 76 4e-12 ref|NP_001242111.1| uncharacterized protein LOC100787003 [Glycin... 75 9e-12 ref|XP_007139241.1| hypothetical protein PHAVU_008G013100g [Phas... 74 2e-11 gb|AGV54627.1| hypothetical protein [Phaseolus vulgaris] 74 2e-11 ref|XP_007218067.1| hypothetical protein PRUPE_ppa006240mg [Prun... 74 2e-11 gb|EXB52244.1| hypothetical protein L484_001846 [Morus notabilis] 74 3e-11 ref|XP_002283917.1| PREDICTED: uncharacterized protein LOC100256... 74 3e-11 >ref|XP_004492116.1| PREDICTED: uncharacterized protein LOC101495407 [Cicer arietinum] Length = 420 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES E+PL++++AR+QIVDKVRRTLMGW Sbjct: 377 RHSTQERQWEVYRFLLDESREFPLNSSKARSQIVDKVRRTLMGW 420 >gb|AFK39862.1| unknown [Medicago truncatula] Length = 339 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES ++PL++++AR+QIVDKVRRTLMGW Sbjct: 296 RHSTQERQWEVYRFLLDESRDFPLNSSKARSQIVDKVRRTLMGW 339 >gb|AFK39044.1| unknown [Medicago truncatula] Length = 418 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES ++PL++++AR+QIVDKVRRTLMGW Sbjct: 375 RHSTQERQWEVYRFLLDESRDFPLNSSKARSQIVDKVRRTLMGW 418 >ref|XP_003621863.1| hypothetical protein MTR_7g024320 [Medicago truncatula] gi|355496878|gb|AES78081.1| hypothetical protein MTR_7g024320 [Medicago truncatula] Length = 433 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES ++PL++++AR+QIVDKVRRTLMGW Sbjct: 390 RHSTQERQWEVYRFLLDESRDFPLNSSKARSQIVDKVRRTLMGW 433 >ref|XP_003621862.1| hypothetical protein MTR_7g024320 [Medicago truncatula] gi|355496877|gb|AES78080.1| hypothetical protein MTR_7g024320 [Medicago truncatula] Length = 418 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES ++PL++++AR+QIVDKVRRTLMGW Sbjct: 375 RHSTQERQWEVYRFLLDESRDFPLNSSKARSQIVDKVRRTLMGW 418 >gb|ACJ84336.1| unknown [Medicago truncatula] Length = 418 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLLDES ++PL++++AR+QIVDKVRRTLMGW Sbjct: 375 RHSTQERQWEVYRFLLDESRDFPLNSSKARSQIVDKVRRTLMGW 418 >ref|XP_006411185.1| hypothetical protein EUTSA_v10016727mg [Eutrema salsugineum] gi|557112354|gb|ESQ52638.1| hypothetical protein EUTSA_v10016727mg [Eutrema salsugineum] Length = 414 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDES E+PL++ RARNQIVD+V +TLMGW Sbjct: 371 RHSTLDRQWEVYRFLLDESREFPLASLRARNQIVDRVTKTLMGW 414 >ref|XP_002879806.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325645|gb|EFH56065.1| ACT domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDES E+PL++ RARNQ+VD+V +TLMGW Sbjct: 368 RHSTLDRQWEVYRFLLDESREFPLASLRARNQVVDRVTKTLMGW 411 >gb|AAK74028.1| At2g39570/F12L6.23 [Arabidopsis thaliana] gi|23308377|gb|AAN18158.1| At2g39570/F12L6.23 [Arabidopsis thaliana] Length = 411 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDES E+PL++ RARNQ+VD+V +TLMGW Sbjct: 368 RHSTLDRQWEVYRFLLDESREFPLASLRARNQVVDRVTKTLMGW 411 >ref|NP_565908.1| ACT domain-containing protein [Arabidopsis thaliana] gi|3355486|gb|AAC27848.1| expressed protein [Arabidopsis thaliana] gi|330254601|gb|AEC09695.1| ACT domain-containing protein [Arabidopsis thaliana] gi|347949474|gb|AEP31950.1| ACT domain-containing protein [Arabidopsis thaliana] Length = 411 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDES E+PL++ RARNQ+VD+V +TLMGW Sbjct: 368 RHSTLDRQWEVYRFLLDESREFPLASLRARNQVVDRVTKTLMGW 411 >ref|XP_006294312.1| hypothetical protein CARUB_v10023319mg [Capsella rubella] gi|482563020|gb|EOA27210.1| hypothetical protein CARUB_v10023319mg [Capsella rubella] Length = 411 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDES E PL++ RARNQIVD+V +TLMGW Sbjct: 368 RHSTLDRQWEVYRFLLDESRELPLASLRARNQIVDRVTKTLMGW 411 >ref|XP_002312081.1| ACT domain-containing family protein [Populus trichocarpa] gi|222851901|gb|EEE89448.1| ACT domain-containing family protein [Populus trichocarpa] Length = 421 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST DRQWEVYRFLLDE+ + PL++++ARNQIVD++RRTLMGW Sbjct: 378 RHSTQDRQWEVYRFLLDENCDVPLASSQARNQIVDRIRRTLMGW 421 >ref|XP_006436032.1| hypothetical protein CICLE_v10031651mg [Citrus clementina] gi|568865429|ref|XP_006486078.1| PREDICTED: uncharacterized protein LOC102612803 [Citrus sinensis] gi|557538228|gb|ESR49272.1| hypothetical protein CICLE_v10031651mg [Citrus clementina] Length = 419 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/44 (75%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHSTS RQWEVYRFLLDES E+PL++++ARN+IV+KV++TLMGW Sbjct: 376 RHSTSHRQWEVYRFLLDESLEFPLASSQARNRIVEKVKKTLMGW 419 >ref|XP_002298369.1| ACT domain-containing family protein [Populus trichocarpa] gi|222845627|gb|EEE83174.1| ACT domain-containing family protein [Populus trichocarpa] Length = 417 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 R+STSDR+WE+YRFLL+E+ E+ LSN ARNQIVDKVRRTLMGW Sbjct: 374 RYSTSDREWEIYRFLLEENCEFQLSNMMARNQIVDKVRRTLMGW 417 >ref|NP_001242111.1| uncharacterized protein LOC100787003 [Glycine max] gi|255636202|gb|ACU18442.1| unknown [Glycine max] Length = 419 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEV+RFLL+ES ++PL+ ++AR QIVDKVRRTLMGW Sbjct: 376 RHSTQERQWEVHRFLLEESRDFPLTRSQARTQIVDKVRRTLMGW 419 >ref|XP_007139241.1| hypothetical protein PHAVU_008G013100g [Phaseolus vulgaris] gi|561012374|gb|ESW11235.1| hypothetical protein PHAVU_008G013100g [Phaseolus vulgaris] Length = 419 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLL+E+ +PL+ ++ R+QIVDKVRRTLMGW Sbjct: 376 RHSTQERQWEVYRFLLEENRNFPLTRSQTRSQIVDKVRRTLMGW 419 >gb|AGV54627.1| hypothetical protein [Phaseolus vulgaris] Length = 419 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST +RQWEVYRFLL+E+ +PL+ ++ R+QIVDKVRRTLMGW Sbjct: 376 RHSTQERQWEVYRFLLEENRNFPLTRSQTRSQIVDKVRRTLMGW 419 >ref|XP_007218067.1| hypothetical protein PRUPE_ppa006240mg [Prunus persica] gi|462414529|gb|EMJ19266.1| hypothetical protein PRUPE_ppa006240mg [Prunus persica] Length = 421 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHST D QWEVYRFLLD+S E+PLS+ +AR +IV+KVRRTLMGW Sbjct: 378 RHSTLDCQWEVYRFLLDDSREFPLSSKQARGKIVEKVRRTLMGW 421 >gb|EXB52244.1| hypothetical protein L484_001846 [Morus notabilis] Length = 420 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHS SDR+WEVYRFLL+ES + LSN ARNQIVD+VRR LMGW Sbjct: 377 RHSASDREWEVYRFLLEESSRFQLSNMMARNQIVDRVRRILMGW 420 >ref|XP_002283917.1| PREDICTED: uncharacterized protein LOC100256399 [Vitis vinifera] gi|296086260|emb|CBI31701.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/44 (70%), Positives = 42/44 (95%) Frame = -3 Query: 505 RHSTSDRQWEVYRFLLDESHEYPLSNARARNQIVDKVRRTLMGW 374 RHSTS+R+WEVYRF L+ES E+PL+++R+R+QIVD+V+RTLMGW Sbjct: 369 RHSTSNREWEVYRFRLEESVEFPLTSSRSRSQIVDRVKRTLMGW 412