BLASTX nr result
ID: Sinomenium21_contig00024938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024938 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379740.1| hypothetical protein POPTR_0008s11970g [Popu... 63 5e-08 ref|XP_006378483.1| hypothetical protein POPTR_0010s13470g [Popu... 58 1e-06 >ref|XP_006379740.1| hypothetical protein POPTR_0008s11970g [Populus trichocarpa] gi|550332891|gb|ERP57537.1| hypothetical protein POPTR_0008s11970g [Populus trichocarpa] Length = 106 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 198 KVINESGSFTNGFNRTKEGFEESKRRVPSCPDPLHN 305 K NE G+ ++GFN+T++GFEESKRRVPSCPDPLHN Sbjct: 71 KYFNERGNTSHGFNKTEKGFEESKRRVPSCPDPLHN 106 >ref|XP_006378483.1| hypothetical protein POPTR_0010s13470g [Populus trichocarpa] gi|550329724|gb|ERP56280.1| hypothetical protein POPTR_0010s13470g [Populus trichocarpa] Length = 105 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 198 KVINESGSFTNGFNRTKEGFEESKRRVPSCPDPLHN 305 K NE + + GFN+T++GFEE+KRRVPSCPDPLHN Sbjct: 70 KYFNERANTSYGFNKTEKGFEENKRRVPSCPDPLHN 105