BLASTX nr result
ID: Sinomenium21_contig00024869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024869 (1194 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001763120.1| predicted protein [Physcomitrella patens] gi... 59 5e-06 ref|XP_006283407.1| hypothetical protein CARUB_v10004456mg [Caps... 58 7e-06 ref|XP_003557725.1| PREDICTED: glucose-6-phosphate 1-dehydrogena... 58 7e-06 >ref|XP_001763120.1| predicted protein [Physcomitrella patens] gi|162685603|gb|EDQ71997.1| predicted protein [Physcomitrella patens] Length = 522 Score = 58.5 bits (140), Expect = 5e-06 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = +2 Query: 236 NIFVDVVRAASTLASSANGW----IEKPFGWDFESSGTLTRGLKWKIK 367 NIFVDV R++S ASSANGW +EKPFG D ESS LTRGLK +K Sbjct: 150 NIFVDVARSSSLAASSANGWTRVIVEKPFGRDSESSAELTRGLKTYLK 197 >ref|XP_006283407.1| hypothetical protein CARUB_v10004456mg [Capsella rubella] gi|482552112|gb|EOA16305.1| hypothetical protein CARUB_v10004456mg [Capsella rubella] Length = 578 Score = 58.2 bits (139), Expect = 7e-06 Identities = 32/44 (72%), Positives = 33/44 (75%), Gaps = 4/44 (9%) Frame = +2 Query: 236 NIFVDVVRAASTLASSANGW----IEKPFGWDFESSGTLTRGLK 355 NIFVDVVR AS ASSANGW +EKPFG D ESSG LTR LK Sbjct: 210 NIFVDVVRCASLRASSANGWTRVIVEKPFGRDSESSGELTRCLK 253 >ref|XP_003557725.1| PREDICTED: glucose-6-phosphate 1-dehydrogenase, chloroplastic-like [Brachypodium distachyon] Length = 570 Score = 58.2 bits (139), Expect = 7e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 4/44 (9%) Frame = +2 Query: 236 NIFVDVVRAASTLASSANGW----IEKPFGWDFESSGTLTRGLK 355 NIFVDVVR+AS ASS +GW +EKPFG D+ESSG LTR LK Sbjct: 199 NIFVDVVRSASRTASSPSGWTRFIVEKPFGRDYESSGELTRSLK 242