BLASTX nr result
ID: Sinomenium21_contig00024464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024464 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis ... 124 1e-26 ref|YP_001294292.1| ribosomal protein S18 [Illicium oligandrum] ... 92 6e-17 gb|AHM88890.1| ribosomal protein S18 (chloroplast) [Lagenaria si... 89 6e-16 gb|AHM88716.1| ribosomal protein S18 (chloroplast) [Lagenaria si... 89 6e-16 ref|YP_009002277.1| ribosomal protein S18 (chloroplast) [Pinguic... 89 6e-16 ref|YP_008999957.1| ribosomal protein S18 (chloroplast) [Agroste... 89 6e-16 ref|YP_008994311.1| ribosomal protein S18 [Melianthus villosus] ... 89 6e-16 ref|YP_008964056.1| ribosomal protein S18 [Ajuga reptans] gi|558... 89 6e-16 gb|AHA12946.1| ribosomal protein S18 [Monocostus uniflorus] 89 6e-16 gb|AHA12777.1| ribosomal protein S18 [Canna indica] 89 6e-16 ref|YP_008758210.1| 30S ribosomal protein S18 (chloroplast) [Ver... 89 6e-16 gb|AGQ55697.1| ribosomal protein S18 (chloroplast) [Alstroemeria... 89 6e-16 gb|AGW04919.1| ribosomal protein S18 [Telosma cordata] 89 6e-16 gb|AGW04842.1| ribosomal protein S18 [Sisyranthus trichostomus] 89 6e-16 gb|AGW04611.1| ribosomal protein S18 [Marsdenia astephanoides] 89 6e-16 ref|YP_008578194.1| ribosomal protein S18 (chloroplast) [Stockwe... 89 6e-16 ref|YP_008578109.1| ribosomal protein S18 (chloroplast) [Allosyn... 89 6e-16 ref|YP_008577089.1| ribosomal protein S18 (chloroplast) [Eucalyp... 89 6e-16 ref|YP_008575984.1| ribosomal protein S18 (chloroplast) [Eucalyp... 89 6e-16 ref|YP_008575134.1| ribosomal protein S18 (chloroplast) [Eucalyp... 89 6e-16 >ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis aphrodite subsp. formosana] gi|58802839|gb|AAW82559.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 85 Score = 124 bits (311), Expect = 1e-26 Identities = 59/65 (90%), Positives = 60/65 (92%) Frame = +3 Query: 252 IYFFLVRGPVVLGVDSVLSNCFSLLRKGNKDKIRACFIAIVINRCCFKVNLFTRLDKIFP 431 IY FLV GPVVLG+DS LSNCFSLLRKGNKDKIRACFIAIVINRCCFKVNLF RLDKIFP Sbjct: 13 IYLFLVLGPVVLGIDSTLSNCFSLLRKGNKDKIRACFIAIVINRCCFKVNLFVRLDKIFP 72 Query: 432 CSLIN 446 CSL N Sbjct: 73 CSLRN 77 >ref|YP_001294292.1| ribosomal protein S18 [Illicium oligandrum] gi|205831394|sp|A6MMW6.1|RR18_ILLOL RecName: Full=30S ribosomal protein S18, chloroplastic gi|147917417|gb|ABQ52541.1| ribosomal protein S18 [Illicium oligandrum] Length = 108 Score = 92.4 bits (228), Expect = 6e-17 Identities = 53/70 (75%), Positives = 53/70 (75%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQFXXXXXXXXXXXXXX 266 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILS LPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSSLPFLNNEKQFERTESTPRTTGTRA 98 Query: 265 RKK*IGLFLN 236 RKK IGL LN Sbjct: 99 RKKKIGLLLN 108 >gb|AHM88890.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AHM88716.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645313|gb|AHM88775.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645489|gb|AHM88948.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645548|gb|AHM89006.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645608|gb|AHM89065.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645668|gb|AHM89124.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645728|gb|AHM89183.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645788|gb|AHM89242.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645848|gb|AHM89301.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645909|gb|AHM89361.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595645969|gb|AHM89420.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646029|gb|AHM89479.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646089|gb|AHM89538.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646150|gb|AHM89598.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646210|gb|AHM89657.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646270|gb|AHM89716.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646330|gb|AHM89775.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646390|gb|AHM89834.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646450|gb|AHM89893.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646510|gb|AHM89952.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646570|gb|AHM90011.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646630|gb|AHM90070.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646690|gb|AHM90129.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646750|gb|AHM90188.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646810|gb|AHM90247.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646870|gb|AHM90306.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646930|gb|AHM90365.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595646990|gb|AHM90424.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647050|gb|AHM90483.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647110|gb|AHM90542.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647170|gb|AHM90601.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647230|gb|AHM90660.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647290|gb|AHM90719.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647350|gb|AHM90778.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647410|gb|AHM90837.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647470|gb|AHM90896.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647530|gb|AHM90955.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647590|gb|AHM91014.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647650|gb|AHM91073.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] gi|595647887|gb|AHM91306.1| ribosomal protein S18 (chloroplast) [Lagenaria siceraria] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_009002277.1| ribosomal protein S18 (chloroplast) [Pinguicula ehlersiae] gi|575882159|emb|CDL78833.1| ribosomal protein S18 (chloroplast) [Pinguicula ehlersiae] Length = 134 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008999957.1| ribosomal protein S18 (chloroplast) [Agrostemma githago] gi|555944043|gb|AGZ17947.1| ribosomal protein S18 (chloroplast) [Agrostemma githago] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008994311.1| ribosomal protein S18 [Melianthus villosus] gi|527355161|gb|AGS13030.1| ribosomal protein S18 [Melianthus villosus] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008964056.1| ribosomal protein S18 [Ajuga reptans] gi|558697191|gb|AHA84946.1| ribosomal protein S18 [Ajuga reptans] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AHA12946.1| ribosomal protein S18 [Monocostus uniflorus] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AHA12777.1| ribosomal protein S18 [Canna indica] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008758210.1| 30S ribosomal protein S18 (chloroplast) [Veratrum patulum] gi|549531739|gb|AGX28865.1| 30S ribosomal protein S18 (chloroplast) [Veratrum patulum] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AGQ55697.1| ribosomal protein S18 (chloroplast) [Alstroemeria aurea] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AGW04919.1| ribosomal protein S18 [Telosma cordata] Length = 111 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AGW04842.1| ribosomal protein S18 [Sisyranthus trichostomus] Length = 107 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >gb|AGW04611.1| ribosomal protein S18 [Marsdenia astephanoides] Length = 107 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008578194.1| ribosomal protein S18 (chloroplast) [Stockwellia quadrifida] gi|442569442|gb|AGC59603.1| ribosomal protein S18 (chloroplast) [Stockwellia quadrifida] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008578109.1| ribosomal protein S18 (chloroplast) [Allosyncarpia ternata] gi|442569356|gb|AGC59518.1| ribosomal protein S18 (chloroplast) [Allosyncarpia ternata] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008577089.1| ribosomal protein S18 (chloroplast) [Eucalyptus torquata] gi|442568324|gb|AGC58498.1| ribosomal protein S18 (chloroplast) [Eucalyptus torquata] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008575984.1| ribosomal protein S18 (chloroplast) [Eucalyptus cloeziana] gi|442567034|gb|AGC57223.1| ribosomal protein S18 (chloroplast) [Eucalyptus cloeziana] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84 >ref|YP_008575134.1| ribosomal protein S18 (chloroplast) [Eucalyptus obliqua] gi|545716352|ref|YP_008575219.1| ribosomal protein S18 (chloroplast) [Eucalyptus radiata] gi|545716438|ref|YP_008575304.1| ribosomal protein S18 (chloroplast) [Eucalyptus delegatensis] gi|545716524|ref|YP_008575389.1| ribosomal protein S18 (chloroplast) [Eucalyptus verrucata] gi|545716610|ref|YP_008575474.1| ribosomal protein S18 (chloroplast) [Eucalyptus baxteri] gi|545716696|ref|YP_008575559.1| ribosomal protein S18 (chloroplast) [Eucalyptus diversifolia] gi|545716782|ref|YP_008575644.1| ribosomal protein S18 (chloroplast) [Eucalyptus sieberi] gi|545716868|ref|YP_008575729.1| ribosomal protein S18 (chloroplast) [Eucalyptus elata] gi|545716954|ref|YP_008575814.1| ribosomal protein S18 (chloroplast) [Eucalyptus regnans] gi|545717040|ref|YP_008575899.1| ribosomal protein S18 (chloroplast) [Eucalyptus umbra] gi|545717212|ref|YP_008576069.1| ribosomal protein S18 (chloroplast) [Eucalyptus patens] gi|545717298|ref|YP_008576154.1| ribosomal protein S18 (chloroplast) [Eucalyptus marginata] gi|442566174|gb|AGC56373.1| ribosomal protein S18 (chloroplast) [Eucalyptus obliqua] gi|442566260|gb|AGC56458.1| ribosomal protein S18 (chloroplast) [Eucalyptus radiata] gi|442566346|gb|AGC56543.1| ribosomal protein S18 (chloroplast) [Eucalyptus delegatensis] gi|442566432|gb|AGC56628.1| ribosomal protein S18 (chloroplast) [Eucalyptus verrucata] gi|442566518|gb|AGC56713.1| ribosomal protein S18 (chloroplast) [Eucalyptus baxteri] gi|442566604|gb|AGC56798.1| ribosomal protein S18 (chloroplast) [Eucalyptus diversifolia] gi|442566690|gb|AGC56883.1| ribosomal protein S18 (chloroplast) [Eucalyptus sieberi] gi|442566776|gb|AGC56968.1| ribosomal protein S18 (chloroplast) [Eucalyptus elata] gi|442566862|gb|AGC57053.1| ribosomal protein S18 (chloroplast) [Eucalyptus regnans] gi|442566948|gb|AGC57138.1| ribosomal protein S18 (chloroplast) [Eucalyptus umbra] gi|442567120|gb|AGC57308.1| ribosomal protein S18 (chloroplast) [Eucalyptus patens] gi|442567206|gb|AGC57393.1| ribosomal protein S18 (chloroplast) [Eucalyptus marginata] Length = 101 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -2 Query: 445 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 308 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF Sbjct: 39 FISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNEKQF 84