BLASTX nr result
ID: Sinomenium21_contig00024452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024452 (789 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_006348701.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_007045890.1| Tetratricopeptide repeat-like superfamily pr... 67 7e-09 ref|XP_007045889.1| Tetratricopeptide repeat (TPR)-like superfam... 67 7e-09 ref|XP_004239056.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 gb|EXB44833.1| hypothetical protein L484_026413 [Morus notabilis] 64 5e-08 ref|XP_006415925.1| hypothetical protein EUTSA_v10007071mg [Eutr... 64 5e-08 ref|XP_002512090.1| pentatricopeptide repeat-containing protein,... 64 8e-08 ref|XP_002893403.1| pentatricopeptide repeat-containing protein ... 63 1e-07 gb|EYU28858.1| hypothetical protein MIMGU_mgv1a020475mg [Mimulus... 60 9e-07 gb|EPS71121.1| hypothetical protein M569_03636 [Genlisea aurea] 60 1e-06 ref|XP_006303169.1| hypothetical protein CARUB_v10008572mg [Caps... 60 1e-06 ref|XP_006484190.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-06 ref|NP_564247.1| pentatricopeptide repeat-containing protein [Ar... 58 4e-06 gb|AAM61409.1| unknown [Arabidopsis thaliana] 58 4e-06 ref|XP_002315005.2| pentatricopeptide repeat-containing family p... 57 1e-05 >ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Vitis vinifera] gi|297738080|emb|CBI27281.3| unnamed protein product [Vitis vinifera] Length = 616 Score = 68.2 bits (165), Expect = 3e-09 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYES+D VE LA+KFKIRMGTENRR MLFNL Y+TEY Sbjct: 576 REMDYESNDQVESLARKFKIRMGTENRRDMLFNLAYNTEY 615 >ref|XP_006348701.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Solanum tuberosum] Length = 617 Score = 67.0 bits (162), Expect = 7e-09 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESDD VE+L KKF IRMGTENRR MLFNL Y+ EY Sbjct: 576 REMDYESDDRVEELTKKFNIRMGTENRRNMLFNLRYNMEY 615 >ref|XP_007045890.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508709825|gb|EOY01722.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 444 Score = 67.0 bits (162), Expect = 7e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESDD VE LAKKF I+MG+ENRR MLFNL+Y TEY Sbjct: 401 REMDYESDDRVESLAKKFNIQMGSENRRGMLFNLDYGTEY 440 >ref|XP_007045889.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508709824|gb|EOY01721.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 616 Score = 67.0 bits (162), Expect = 7e-09 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESDD VE LAKKF I+MG+ENRR MLFNL+Y TEY Sbjct: 573 REMDYESDDRVESLAKKFNIQMGSENRRGMLFNLDYGTEY 612 >ref|XP_004239056.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Solanum lycopersicum] Length = 617 Score = 65.1 bits (157), Expect = 3e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESDD VE+L KKF IRMG ENRR MLFNL Y+ EY Sbjct: 576 REMDYESDDRVEELTKKFNIRMGAENRRNMLFNLRYNMEY 615 >gb|EXB44833.1| hypothetical protein L484_026413 [Morus notabilis] Length = 665 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYES+D V+ A K+KIRMGTENRR MLFNL YSTEY Sbjct: 624 REMDYESNDRVQSFAVKYKIRMGTENRRDMLFNLRYSTEY 663 >ref|XP_006415925.1| hypothetical protein EUTSA_v10007071mg [Eutrema salsugineum] gi|557093696|gb|ESQ34278.1| hypothetical protein EUTSA_v10007071mg [Eutrema salsugineum] Length = 625 Score = 64.3 bits (155), Expect = 5e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYS 677 RE DYE++DHVE LAKKF+IRMG+ENRR MLFNL+YS Sbjct: 585 REIDYENNDHVESLAKKFEIRMGSENRRNMLFNLDYS 621 >ref|XP_002512090.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549270|gb|EEF50759.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 63.5 bits (153), Expect = 8e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DY+SDD V +AK KIRMGTENRR MLFNLEYST+Y Sbjct: 578 REMDYDSDDRVGSVAKNCKIRMGTENRRDMLFNLEYSTDY 617 >ref|XP_002893403.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339245|gb|EFH69662.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 630 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYS 677 RE DYE+DD VE LAKKF+IRMGTENRR MLFN++YS Sbjct: 587 REMDYENDDQVEALAKKFQIRMGTENRRNMLFNIDYS 623 >gb|EYU28858.1| hypothetical protein MIMGU_mgv1a020475mg [Mimulus guttatus] Length = 606 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESD+ VE LA++FKIRMGTE RR +LFNL Y T+Y Sbjct: 566 REMDYESDEKVESLARQFKIRMGTEVRRDLLFNLHYITDY 605 >gb|EPS71121.1| hypothetical protein M569_03636 [Genlisea aurea] Length = 618 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE DYESDD V+ AKKF IR+G+E RR LFNL+YSTEY Sbjct: 578 REMDYESDDKVDWFAKKFNIRLGSETRRDALFNLQYSTEY 617 >ref|XP_006303169.1| hypothetical protein CARUB_v10008572mg [Capsella rubella] gi|482571880|gb|EOA36067.1| hypothetical protein CARUB_v10008572mg [Capsella rubella] Length = 630 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYS 677 RE D E+DD VE LAKKF+IRMGTENRR MLFN++YS Sbjct: 587 REMDNENDDQVEALAKKFQIRMGTENRRNMLFNIDYS 623 >ref|XP_006484190.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X1 [Citrus sinensis] Length = 613 Score = 57.8 bits (138), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE D ES+D VE LAKKF IRM TENR+ +LFNLEYS Y Sbjct: 573 REMDEESNDRVEALAKKFDIRMNTENRKNILFNLEYSASY 612 >ref|NP_564247.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75173405|sp|Q9FZD1.1|PPR58_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g26460, mitochondrial; Flags: Precursor gi|9797754|gb|AAF98572.1|AC013427_15 Contains similarity to a hypothetical protein F21B7.16 gi|7485908 from Arabidopsis thaliana BAC F21B7 gb|AC002560 and contains multiple PPR PF|01535 repeats and a domain of unknown function PF|00668. ESTs gb|T45755, gb|AI993167, gb|AV554476, gb|T46823, gb|T41981, gb|AV546597, gb|AI099868 come from this gene [Arabidopsis thaliana] gi|19698979|gb|AAL91225.1| unknown protein [Arabidopsis thaliana] gi|22136300|gb|AAM91228.1| unknown protein [Arabidopsis thaliana] gi|332192573|gb|AEE30694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 630 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYS 677 RE D E+DD VE LAKKF+IRMG+ENRR MLFN++YS Sbjct: 587 REMDDENDDQVEALAKKFQIRMGSENRRNMLFNIDYS 623 >gb|AAM61409.1| unknown [Arabidopsis thaliana] Length = 630 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYS 677 RE D E+DD VE LAKKF+IRMG+ENRR MLFN++YS Sbjct: 587 REMDDENDDQVEALAKKFQIRMGSENRRNMLFNIDYS 623 >ref|XP_002315005.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550329962|gb|EEF01176.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 623 Score = 56.6 bits (135), Expect = 1e-05 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 787 REFDYESDDHVEDLAKKFKIRMGTENRRLMLFNLEYSTEY 668 RE +YESDD VE A+KF R+G++NRR +LFNLEYST++ Sbjct: 583 REMEYESDDRVEFWARKFDYRLGSQNRRDLLFNLEYSTDF 622