BLASTX nr result
ID: Sinomenium21_contig00024432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024432 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514128.1| hypothetical protein RCOM_1047200 [Ricinus c... 58 1e-06 >ref|XP_002514128.1| hypothetical protein RCOM_1047200 [Ricinus communis] gi|223546584|gb|EEF48082.1| hypothetical protein RCOM_1047200 [Ricinus communis] Length = 229 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/51 (58%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -3 Query: 433 ERAKEEVEALVEAIQPKKKSTSHDSSP---KKGSGGPFASIGRRFEKICSP 290 +RAKEE+EA+VEAI PKK+++ DSS K+ GG ASIGR EK+CSP Sbjct: 153 QRAKEEIEAIVEAIHPKKETSGFDSSSPLRKEEDGGLGASIGRGLEKVCSP 203