BLASTX nr result
ID: Sinomenium21_contig00024407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024407 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007019173.1| Tetratricopeptide repeat (TPR)-like superfam... 57 3e-06 ref|XP_007224224.1| hypothetical protein PRUPE_ppa017885mg [Prun... 57 3e-06 ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|NP_001051352.1| Os03g0761300 [Oryza sativa Japonica Group] g... 56 6e-06 >ref|XP_007019173.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599410|ref|XP_007019174.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599414|ref|XP_007019175.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599418|ref|XP_007019176.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590599423|ref|XP_007019177.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724501|gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724502|gb|EOY16399.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724503|gb|EOY16400.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724504|gb|EOY16401.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724505|gb|EOY16402.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 480 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 1 TFGRLRQLLIKERRGDVLVFLVEKTNLLIKEPLFD 105 TFGRLRQLLIKE R DVL FL EK NLLIKEPL+D Sbjct: 446 TFGRLRQLLIKEGREDVLKFLQEKMNLLIKEPLYD 480 >ref|XP_007224224.1| hypothetical protein PRUPE_ppa017885mg [Prunus persica] gi|462421160|gb|EMJ25423.1| hypothetical protein PRUPE_ppa017885mg [Prunus persica] Length = 464 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 1 TFGRLRQLLIKERRGDVLVFLVEKTNLLIKEPLFD 105 TFGRLRQLLIKE R DVL FL EK NLL+KEPLFD Sbjct: 430 TFGRLRQLLIKEGREDVLNFLNEKINLLVKEPLFD 464 >ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Glycine max] Length = 454 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 TFGRLRQLLIKERRGDVLVFLVEKTNLLIKEPLFD 105 TFGRLRQLLIKE R DVL FL EK NLL+KEPL+D Sbjct: 420 TFGRLRQLLIKEGREDVLKFLHEKMNLLVKEPLYD 454 >ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Glycine max] gi|571460055|ref|XP_006581592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Glycine max] gi|571460057|ref|XP_006581593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Glycine max] gi|571460059|ref|XP_006581594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X5 [Glycine max] gi|571460061|ref|XP_006581595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X6 [Glycine max] Length = 481 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 1 TFGRLRQLLIKERRGDVLVFLVEKTNLLIKEPLFD 105 TFGRLRQLLIKE R DVL FL EK NLL+KEPL+D Sbjct: 447 TFGRLRQLLIKEGREDVLKFLHEKMNLLVKEPLYD 481 >ref|NP_001051352.1| Os03g0761300 [Oryza sativa Japonica Group] gi|14488357|gb|AAK63924.1|AC084282_5 unknown protein [Oryza sativa Japonica Group] gi|108711214|gb|ABF99009.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113549823|dbj|BAF13266.1| Os03g0761300 [Oryza sativa Japonica Group] gi|125545804|gb|EAY91943.1| hypothetical protein OsI_13630 [Oryza sativa Indica Group] gi|125588003|gb|EAZ28667.1| hypothetical protein OsJ_12678 [Oryza sativa Japonica Group] Length = 484 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 TFGRLRQLLIKERRGDVLVFLVEKTNLLIKEPLFD 105 TFG+LRQLL+KE R DVL FLVEK N+LI+EPLFD Sbjct: 450 TFGKLRQLLLKEGRKDVLDFLVEKMNILIQEPLFD 484