BLASTX nr result
ID: Sinomenium21_contig00024071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00024071 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041139.1| Glycolipid transfer protein (GLTP) family pr... 63 5e-08 ref|XP_006448928.1| hypothetical protein CICLE_v10016636mg [Citr... 57 3e-06 ref|XP_004293995.1| PREDICTED: glycolipid transfer protein domai... 55 1e-05 >ref|XP_007041139.1| Glycolipid transfer protein (GLTP) family protein [Theobroma cacao] gi|508705074|gb|EOX96970.1| Glycolipid transfer protein (GLTP) family protein [Theobroma cacao] Length = 205 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 2 ASARIQMQNYVTASGPVILFVDKLFHSRNLGTDW 103 ASARIQMQNYVTASGP+IL++D+LF SR LGTDW Sbjct: 172 ASARIQMQNYVTASGPIILYIDQLFLSRELGTDW 205 >ref|XP_006448928.1| hypothetical protein CICLE_v10016636mg [Citrus clementina] gi|557551539|gb|ESR62168.1| hypothetical protein CICLE_v10016636mg [Citrus clementina] Length = 205 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 5 SARIQMQNYVTASGPVILFVDKLFHSRNLGTDW 103 SARIQMQNY+T S PVIL++DKLF SR LG DW Sbjct: 173 SARIQMQNYITTSAPVILYIDKLFLSRELGIDW 205 >ref|XP_004293995.1| PREDICTED: glycolipid transfer protein domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 202 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +2 Query: 5 SARIQMQNYVTASGPVILFVDKLFHSRNLGTDW 103 SA+ QMQNYV AS P+IL++DKLF +RNLG DW Sbjct: 170 SAKAQMQNYVAASAPLILYIDKLFQTRNLGVDW 202