BLASTX nr result
ID: Sinomenium21_contig00023947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00023947 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chai... 56 5e-06 >gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chain [Aegilops tauschii] Length = 950 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 488 ILLCKVRLRTIDPKWSDPSPRPRICGSFVHRAVLF 384 +L C+ RLRTIDPKWSDPSP P GS++HRA LF Sbjct: 29 LLKCRERLRTIDPKWSDPSPDPCASGSYMHRAALF 63